SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000009864 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000009864
Domain Number 1 Region: 74-227
Classification Level Classification E-value
Superfamily vWA-like 0.00000000608
Family Trunk domain of Sec23/24 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000009864   Gene: ENSECAG00000011959   Transcript: ENSECAT00000012485
Sequence length 968
Comment pep:known chromosome:EquCab2:19:22550078:22557266:1 gene:ENSECAG00000011959 transcript:ENSECAT00000012485 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLEAGSLSSAEYEAWVRARRDFQRLQRRDSDGDRQVWFLQRRFHKDILLNPVLVLSFCPD
LSSKPGQLGSATRELLFLLDSSSIAHKDAIVLAVKSLPSQTLINLAIFGTSVQPLFLESR
PCSDDTVQLICESLETLQAVSGPPDVLAALDWAMGQPQHRAHPRQLFLLTAASPMATVTH
QTLELMRWHRGAARCFSFGLGPACHQLLQGLSALSRGQAYFLRPGERLQPLLVQALRKAL
EPALSDISVDWFVPDAVEALLTPREIPALYPGDQLLGYCSLFRVDSFRPRPPRGQEPGWQ
SLGGSVFPSPEEAPSATSPGTEPTGTSEPLGTGTVSAELSSPWAAGDSEQSTDALTDPVT
DPGPNPSSDTAIWRRIFQSSYIREQYVLTHCSASPEPGPGSTGSSESPGSQGPGSPEGNT
ALHPPSQQGCRSLACGEPAGSRSCPLPVPPLTPVKAGALSAEVLGRRCRVALAGRSLSSP
PGRVNPVPGRPRHPSLGAAPDGPGPEPGQQLGQGLDDSGNLLSPAPMDWDMLMEPPFLFT
AVPPNGESAPAAVPLAPLTPRCHVVIRALCGEQPMCWEVGLGLETLWGPGDDGSLPPSPP
EREGAWDQALHRLTAASLVRDNEQLALRGGAETMADRGHARRSWLRALQTSKVSSAPSCF
TCPVAVDATTREVLPSALQVRSSEPAEPPGTPPASQNCQDAALLPAVVHSKGPHGGSLAG
RWDQDRNGNSKPASGAPAAPTRGLHRPPPQPPSRLSLGHSRKLCSPNMGQASDDKSDGSD
HDYLPLVRLQEAPGSFRLDAPFCAAVRIPQERLCRASPFAAHRASLSPTSASSPWALLGP
GVGQGDSATASCSPSPSSGSEGPGQADSGRGSDTEASEGAEGPCGADLRGRTWATAVALA
WLEHRCAAAFGEWELAAAKADCWLRAQHLPDGLDLAALKAAARGLFLLLRHWDQNLQLHL
LCYSPANM
Download sequence
Identical sequences F6VES4
9796.ENSECAP00000009864 ENSECAP00000009864 ENSECAP00000009864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]