SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000009902 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000009902
Domain Number 1 Region: 488-527
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000148
Family EGF-type module 0.0084
Further Details:      
 
Domain Number 2 Region: 324-455
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000596
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 3 Region: 296-338
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000317
Family EGF-type module 0.011
Further Details:      
 
Domain Number 4 Region: 257-304
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000554
Family EGF-type module 0.016
Further Details:      
 
Domain Number 5 Region: 3-42
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000037
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 6 Region: 451-492
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000955
Family EGF-type module 0.03
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000009902
Domain Number - Region: 225-256
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000122
Family EGF-type module 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000009902   Gene: ENSECAG00000011871   Transcript: ENSECAT00000012531
Sequence length 644
Comment pep:known chromosome:EquCab2:6:17088442:17268616:-1 gene:ENSECAG00000011871 transcript:ENSECAT00000012531 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLVVDPCASNPCHHGNCSSSGSGDGYLCICNEGYEGPNCGQALPTLPASGWTESMAPRQL
QPVPATQEPDIILPRSQATVTLPTWQPKTGQKVVEMKWDQVEVIPDIACGNASSNSSAGG
RLVSFEVPQNTSVKIRQDAAASLILLWKVTATGFQQCSLIDGRSVTLLQAPGGLVLLEEM
LALGSNHFIGFVNDSVAKSIVALRLTLVVKASTCVPGDGHANDLECSGKGKCTTKPSEAT
FSCNCDDQYVGTFCEEFDACQRKPCQNNASCIDANEKQDGSNFTCVCLAGYTGELCQSKI
DYCTLDPCRNGATCVSNLNGFTCQCPEGYFGPACEEKVDPCASSPCQNNGTCYADGVHFS
CSCSAGFTGPACAQLVDFCALSPCAHGTCRSVGTSYKCLCDPGYHGLYCEEEYNECLSAP
CLNAATCRDLVNGYECVCLAEYKGIHCESYKDPCANVSCLNGGTCDSEGLNGTCVCAPGF
TGKECDIEINECDSNPCHHAGTCLDQPNGYTCHCPHGWVGANCEIHLQWKSGHMAESLTN
MPRHSLYIIIGALCVAFILMLIILIVGICRISRIEYQGSSRPAYEEFYNCRSIDSEFSNA
IASIRHARFGKKSRPAMYDVTPIAYEDYSPDDKPLVTLIKTKDL
Download sequence
Identical sequences F6TEZ8
ENSECAP00000009902 ENSECAP00000009902 9796.ENSECAP00000009902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]