SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000009917 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000009917
Domain Number 1 Region: 377-630
Classification Level Classification E-value
Superfamily YWTD domain 1.05e-36
Family YWTD domain 0.0000286
Further Details:      
 
Domain Number 2 Region: 688-928
Classification Level Classification E-value
Superfamily YWTD domain 7.72e-29
Family YWTD domain 0.00035
Further Details:      
 
Domain Number 3 Region: 292-362,631-673
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000282
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 4 Region: 117-158
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000393
Family LDL receptor-like module 0.00088
Further Details:      
 
Domain Number 5 Region: 205-245
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 6 Region: 249-280
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000367
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 7 Region: 163-200
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000563
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 8 Region: 2-39
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000563
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 9 Region: 87-119
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000072
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 10 Region: 995-1028
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000144
Family LDL receptor-like module 0.0027
Further Details:      
 
Domain Number 11 Region: 42-80
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000262
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 12 Region: 956-1011
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000156
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000009917   Gene: ENSECAG00000012111   Transcript: ENSECAT00000012552
Sequence length 1028
Comment pep:known chromosome:EquCab2:27:15844943:15858530:1 gene:ENSECAG00000012111 transcript:ENSECAT00000012552 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLLCTRSSVPCRNGQECISRENLCNGEPDCQDGSDEENCSQFCNKPGVFQCLDGDKCIEE
KYHCDGARQCLDGSDEWDCWKPTEDCSLRCDNKTRCIPKSWLCDGHPDCADKKDEQRCIH
EKCGTSEFRCRNGQCISYSLRCDGNRDCLDHSDEEGCPAAWPLRCPGGEVKCPRSGECVL
ADWICDHDLDCKDGTDEKDCDPEELRCGSRQWSCASGDQCVPDSWLCDGQRDCRDGSDEA
GCKCRALSLSEFQCRSHACLNVSLVCDGKEDCADGSDEGGKCSSSACGQAQCSHSCYKSP
QGPTCACEQGFELKSSGQICKDVDECQKLGGQPCSQTCVNTRGSYSCTCHPGYLLEPDGH
TCKATGPEPILLVAIQFNLLLYGLRSLKEDILATTDKNLIIFSIDYDLVEQKIFWTDLGA
ESIKWISMDTKKKGTMVKGIKSDCIVVDWIGRNLYWMDGTAGRILAIQLTAIWRGKSEYT
IVLDDDLNQARSLALDPLNGLMYWSEIGGEPQIEQAGMDGSSRKILINQGLGWPTSIALD
QLSWKIFWSDDKFHCIGSANLDGTGISMLQLTQIKNPFSVAVFEDEVFWSEMKTRTVQRM
KKTTGKNRAVLIKRFEQPYGLKIMHAVLQPRSSNPCLDTGCSHLCLLSPRSKGSCHCPVG
LLLADDGISCVPLEESAFLFLVFPTVITQIYVKNLETSLGQATLPEHRILPFTNVNQLAS
VDYLVQEKTLYLSESDSGDIRLLRLKESGKLSWRKIISVEGTVIDLAVDWFSGNIYWIDS
ENPHISVASSKGQYSTVLFSENLYRPTSVVLHPPTAIMCFVDQGSQEDSKRGSSIECASM
DGSRRKVLWQKSEVPVGLTFSDSETRVYWADAGRGLIESIQQDGSRYRVDRRGIQGLNLF
TYGQGMMFWTTIDDAQITKVWYSKAELVENRWFQVDQKIVDLKVYSKLNQQGSNSCSKDN
GGCSHICLPNPEGQTCKCPRGYYLAGTSKCIEAAQCAAPLQSCKDGQKCIPMEQVCDGRA
DCLDGSDE
Download sequence
Identical sequences F6TE37
ENSECAP00000009917 ENSECAP00000009917 9796.ENSECAP00000009917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]