SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000009928 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000009928
Domain Number 1 Region: 173-269
Classification Level Classification E-value
Superfamily AMPKBI-like 6.41e-35
Family AMPKBI-like 0.00000794
Further Details:      
 
Domain Number 2 Region: 77-160
Classification Level Classification E-value
Superfamily E set domains 8.4e-28
Family AMPK-beta glycogen binding domain-like 0.00000788
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000009928   Gene: ENSECAG00000011947   Transcript: ENSECAT00000012564
Sequence length 269
Comment pep:known chromosome:EquCab2:8:14286510:14295481:-1 gene:ENSECAG00000011947 transcript:ENSECAT00000012564 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNTSSERAALERHGHKTPRRDSSGGAKDGDRPKILMDSPEDADLFHSEEMKAPEKEEFL
AWQHDLEVNDKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSHNNFVAILDLPEG
EHQYKFLVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELSS
SPPGPYHQEPYVSKPEERFKAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYA
LSIKDGVMVLSATHRYKKKYVTTLLYKPI
Download sequence
Identical sequences F6TDG5
ENSECAP00000009928 9796.ENSECAP00000009928 ENSECAP00000009928 NP_001157430.1.31192 XP_008505599.1.77740 XP_014597622.1.31192 XP_014717915.1.49734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]