SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000009953 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSECAP00000009953
Domain Number - Region: 207-231
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00921
Family Integrin beta EGF-like domains 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000009953   Gene: ENSECAG00000012180   Transcript: ENSECAT00000012599
Sequence length 357
Comment pep:known chromosome:EquCab2:13:38043386:38050494:1 gene:ENSECAG00000012180 transcript:ENSECAT00000012599 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSAGGLQNAQFGIRRDGTLVTGYLSEEEVLDTENPFVQLVSGVVWLIRNGSVYVNESQAT
ECDETQETGSFSKFVNVMSARTALGHDRKGQLVLFHADGQTEQRGVNLWEMAEFLLKQDV
FNAINLDGGGSATFVLNGTLTSYPSDHCQENMWRCARHVSTVVCLHEPRCQPPDCSGHGT
CVEGRCQCTGHFWRGAACDELDCGPSNCSQHGLCTEAGCRCEAGWTGSNCSEECPLGWYG
PGCRRPCECEHRCPCDPQTGNCSLAQAPTLNDIVSQDSSIRGLSPAPRTTWLALTLALVF
LLLVSTVVNVSLLLGSRAERSRHLDGTYVYHPLQEMNGELLASEKEQPGDAQNPFKD
Download sequence
Identical sequences F6T6R9
ENSECAP00000009953 ENSECAP00000009953 9796.ENSECAP00000009953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]