SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000009990 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000009990
Domain Number 1 Region: 62-219
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.34e-46
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000009990   Gene: ENSECAG00000012117   Transcript: ENSECAT00000012643
Sequence length 224
Comment pep:known chromosome:EquCab2:X:13690499:13711221:-1 gene:ENSECAG00000012117 transcript:ENSECAT00000012643 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPHKIEGFLFLLLFGYEATLGLSSTEDEGEDPWYHKACKCDCQGGTNTLWSVGATSLDCI
PECPYHKPLGFESGEVTPEQITCSNPEQYVGWYSSWTANKARLNSQGFGCAWLSKFQDSS
QWLQIDLKEVKVISGILTQGRCDIDEWMTKYSVQYRTDESLNWIYYKDQTGNNRVFYGNS
DRTSTVQNLLRPPIISRFIRLIPLGWHVRIAIRMELLECVSKCP
Download sequence
Identical sequences F6WFE8
ENSECAP00000009990 9796.ENSECAP00000009990 ENSECAP00000009990 XP_001491233.3.31192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]