SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000010019 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000010019
Domain Number 1 Region: 5-175
Classification Level Classification E-value
Superfamily E set domains 8.05e-75
Family Arrestin/Vps26-like 0.00000032
Further Details:      
 
Domain Number 2 Region: 177-372
Classification Level Classification E-value
Superfamily E set domains 3.85e-55
Family Arrestin/Vps26-like 0.00000154
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000010019   Gene: ENSECAG00000011730   Transcript: ENSECAT00000012686
Sequence length 393
Comment pep:known chromosome:EquCab2:X:52240095:52251842:1 gene:ENSECAG00000011730 transcript:ENSECAT00000012686 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANTSKVFKKTCSNGKLSIYLGKRDFVDHVDTVEPIDGVVLVDPDYLKGRKMFVMLTCAF
RYGHDDLDVIGLTFRKDLYVQVQQVVPPEPSSPQGPLTVLQERLLHKLGENAYPFTLQMA
VNLPCSVTLQPDPEDTGKACGIDFEVKSFCAENLEEKISKRDSVRLVIRKIQFAPLEPGP
GPSAQTVRRFLLSAQPLQLQAWMDREVHYHGKPISVNVSINNCTNKVIKKIKISVDQTTD
VVLYSLDKYTKTVFTQEFTETIAANSSFSKSFAVTPLLDAKCQKQGLALDGKLKHGDTNL
ASSTILRPGMDKELLGILVSYKVRVNLMVSCGGILGDLTASDVGVELPLILMHPKPSQEA
ASSEDIVIEEFTRQEPGEEESQEALAAEGDEGS
Download sequence
Identical sequences F6QH79
XP_008505509.1.77740 ENSECAP00000010019 ENSECAP00000010019 9796.ENSECAP00000010019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]