SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000010027 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000010027
Domain Number 1 Region: 366-538,580-749
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.7e-44
Family WD40-repeat 0.0034
Further Details:      
 
Domain Number 2 Region: 714-862
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0000000000259
Family Quinoprotein alcohol dehydrogenase-like 0.045
Further Details:      
 
Domain Number 3 Region: 273-384
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 0.000000445
Family Soluble quinoprotein glucose dehydrogenase 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000010027   Gene: ENSECAG00000011974   Transcript: ENSECAT00000012695
Sequence length 889
Comment pep:known chromosome:EquCab2:12:22884313:22892366:-1 gene:ENSECAG00000011974 transcript:ENSECAT00000012695 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGEGPAQEVLRSLSQRLQVQEKEMELVKAALAEALRLLRLQAPPTSLQDAGIPAPTRDSS
PAAPPGLPPTCSPSLVSRGTQTEVQMEPSPGPPGLSNGPPAPQGGSEEPSGTQSEGGGSS
SSGTGSPGPPGILRLVQPPQRADTPRRNSSSSSSPSERPRQKLSRKAASSANLLLRSGST
ESRGGKDPLSSPGGPGSRRSNYNLEGISVKMFLRGRPITMYIPSGIRSLEELPSGPPPET
LSLDWVYGYRGRDSRSNLFVLRSGEVVYFIACVVVLYRPGGGPGGPGGGGQRHYRGHTDC
VRCLAVHPDGVRVASGQTAGVDKDGKPLQPVVHVWDSETLLKLQEIGLGAFERGVGALAF
SVADQGAFLCVVDDSNEHMLSVWDCSRGTKLAEIKSTNDSVLAVGFSPRDSSCIVTSGKS
HVHFWNWSGGVGVPGNGTLTRKQGVFGKYKKPKFIPCFVFLPDGDILTGDSEGNILTWGR
SLSDSRTPGRGGAKETYGIVAQAHAHEGSIFALCLRRDGTVLSGGGRDRRLVQWGPGLVA
LQEAEIPEHFGAVRAIAEGLGSELLVGTTKNALLRGDLAQGFSPVIQGHTDELWGLCTHP
FQNRFLTCGHDRQLCLWDGEGHALAWSIDLKETGLCADFHPSGAVVAVGLNTGRWLVLDT
ETREIVSDVTDGNEQLSVVRYSPDGLYLAIGSHDNMIYIYSVSSDGAKSSRFGRCVGHSS
FITHLDWSKDGNFIMSNSGDYEILYWDVAGGCKLLRNRYESRDREWATYTCVLGFHVYGV
WPDGSDGTDINSLCRSHNERVVAVADDFCKVHLFQYPCARAKAPSLVYGGHGSHVTSVRF
THDDSHLVSLGGKDASIFQWRVLGAGGAGPAPATPSRTPSLSPASSLDV
Download sequence
Identical sequences F6QH14
9796.ENSECAP00000010027 ENSECAP00000010027 ENSECAP00000010027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]