SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000010091 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000010091
Domain Number 1 Region: 402-667
Classification Level Classification E-value
Superfamily YWTD domain 5.23e-52
Family YWTD domain 0.00000224
Further Details:      
 
Domain Number 2 Region: 1045-1272
Classification Level Classification E-value
Superfamily YWTD domain 7.46e-44
Family YWTD domain 0.0000185
Further Details:      
 
Domain Number 3 Region: 717-974
Classification Level Classification E-value
Superfamily YWTD domain 1.03e-43
Family YWTD domain 0.0000212
Further Details:      
 
Domain Number 4 Region: 305-394,668-712
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000196
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 5 Region: 17-62
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000034
Family LDL receptor-like module 0.00069
Further Details:      
 
Domain Number 6 Region: 60-100
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000537
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 7 Region: 146-184
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000445
Family LDL receptor-like module 0.00022
Further Details:      
 
Domain Number 8 Region: 194-230
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000602
Family LDL receptor-like module 0.00057
Further Details:      
 
Domain Number 9 Region: 240-273
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000107
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 10 Region: 105-145
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000123
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 11 Region: 276-312
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000157
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number 12 Region: 984-1031
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000549
Family EGF-type module 0.015
Further Details:      
 
Domain Number 13 Region: 1291-1340
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000199
Family EGF-type module 0.0075
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000010091
Domain Number - Region: 2-21
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0301
Family LDL receptor-like module 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000010091   Gene: ENSECAG00000012212   Transcript: ENSECAT00000012775
Sequence length 1413
Comment pep:known chromosome:EquCab2:18:23958953:24235073:-1 gene:ENSECAG00000012212 transcript:ENSECAT00000012775 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RWKCDGDDDCLDGSDEDSVNCFNHSCPDDQFKCKNNRCIPKRWLCDGANDCGSNEDESNQ
TCAARTCQVDQFSCGNGRCIPRAWLCDREDDCGDQTDEMASCEFPTCEPLSQFICKSGRC
ISSKWHCDSGNNDDCGDGSDEVGCVHSCFDNQFRCSSGRCIPGHWACDGDNDCGDFSDET
QINCTKEEIRSPAGCNGNEFQCHPDGNCIPDLWRCDGEKDCEDGSDEKGCNGTLRLCDHK
TKFSCQSTGRCINKAWVCDGDIDCEDQSDEHDCDSFLCGPPKYPCANDTSVCLQPEKLCN
GRKDCPDGSDEGDLCDECSLNNGGCSNHCSVVPGRGIVCSCPEGLQLNKDNKTCEIVDYC
SSHLKCSQVCEQHKHTVKCSCYEGWKLEVDGESCTSVDPFEAFIIFSIRHEIRRIDLHKR
DYSLLVPGLRNTIALDFHFNQSLLYWTDVVEDRIYRGKLSESGGVSAIEVVVEHGLATPE
GLTVDWIAGNIYWIDSNLDQIEVAKLDGSLRTTLIAGAMEHPRAIALDPRYGILFWTDWD
ANFPRIESASMSGAGRKTIYKDMKTGAWPNGLTVDHFEKRIVWTDARSDAIYSALYDGTG
MIEIIRGHEYLSHPFAVSLYGSEVYWTDWRTNTLSKANKWTGQNVSVIQKTSAQPFDLQI
YHPSRQPQAPNPCAANDGRGPCSHLCLIHHNRSAACACPHLMKLSSDKKTCYEMKKFLLY
ARRSEIRGVDIDNPYFNFITAFTVPDIDDVTVIDFDASEERLYWTDIKTQTIKRAFINGT
GLETVISRDIQSIRGLAVDWVSRNLYWISSEFDETQINVARLDGSLKTSIIHGIDKPQCL
AAHPVRGKLYWTDGNTINMANMDGSNSKILFQNQKEPVGLSIDYVENKLYWISSGNGTIN
RCNLDGGNLEVIESMKEELTKATALTIMDKKLWWADQNLAQLGTCSKRDGRNPTVLRNKT
SGVVHMKVYDNEAQQGKSHCSNSCQLNNGGCSQLCLPTSEITRTCMCTVGYYLQKNRMSC
QGIRSIDIFSNHENTSGLPLFLPNDSSNVCMPWAMSSLPVVCEFRAKNDTIYWTDMGLNK
ISRAKRDQTWKEDIITNGLGRVEGIAIDWIAGNIYWTDHGFNLIEVARLNGSFRYVIISQ
GLDQPRSIAVHPEKGYLFWTEWGQMPCIGKTRLDGSEKVVLVSTGIAWPNGISIDYEENK
LYWCDARTDKIERIDLETGGNREMVLSGSNVDMFSVAVFGAYIYWSDRAHANGSIRRGHK
NDATETVTMRTGLGVNLKEVKIFNRVREKGTNVCAKDNGGCQQLCLYRGNSQRTCACAHG
YLAEDKVTCLRHEGYLLYSGRTILKSIHLSDETNLNSPIRPYENPRYFRNVIALAFDYNQ
RRKGTNRIFYSDAHFGNIQLIKDNWEDRQVIVE
Download sequence
Identical sequences F6QZF2
ENSECAP00000010091 ENSECAP00000010091 9796.ENSECAP00000010091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]