SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Equus caballus 69_2 > ENSECAP00000010092

Domain assignment for ENSECAP00000010092 from Equus caballus 69_2

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSECAP00000010092
Domain Number 1	Region: 209-247
Classification Level	Classification	E-value
Superfamily	EGF/Laminin	0.0000000042
Family	EGF-type module	0.014
Further Details:

Domain Number 2	Region: 89-132
Classification Level	Classification	E-value
Superfamily	EGF/Laminin	0.0000000124
Family	EGF-type module	0.01
Further Details:

Domain Number 3	Region: 167-207
Classification Level	Classification	E-value
Superfamily	EGF/Laminin	0.0000000419
Family	EGF-type module	0.01
Further Details:

Domain Number 4	Region: 131-175
Classification Level	Classification	E-value
Superfamily	EGF/Laminin	0.0000000455
Family	EGF-type module	0.017
Further Details:

Weak hits

Sequence:	ENSECAP00000010092
Domain Number -	Region: 56-105
Classification Level	Classification	E-value
Superfamily	EGF/Laminin	0.00062
Family	EGF-type module	0.054
Further Details:

Domain Number -	Region: 309-366
Classification Level	Classification	E-value
Superfamily	CbiD-like	0.0157
Family	CbiD-like	0.021
Further Details:

Domain Number -	Region: 30-58
Classification Level	Classification	E-value
Superfamily	EGF/Laminin	0.0965
Family	EGF-type module	0.043
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Biological Process	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSECAP00000010092 Gene: ENSECAG00000012122 Transcript: ENSECAT00000012776
Sequence length	383
Comment	pep:known chromosome:EquCab2:24:42604046:42611719:1 gene:ENSECAG00000012122 transcript:ENSECAT00000012776 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MTATAALLPVLLLLLAFGRSAHGAECFPACHPQNGFCEDDNVCRCQPGWQGPLCDQCVTF PGCVHGLCVEPWQCICDDGWDGNLCDLDIRACASTPCANNGTCVNLDSGHYECSCTPGFS GQDCQKKDGPCAINGSPCQHGGSCVDDEGQASHASCLCLPGFSGNFCEIMTNSCIPNPCE NQGICTDIGGDFRCRCPAGFMDKTCSRPVTTCTTDPCLNGGTCLQHSQVRYECLCKPEFT GPLCGKKRVQSPQQVTRLPSGYGLTYRLTPGVHELPVPQPEHHILKVSMKELNKSTPLLS EGQAVCFTILGVLTSLVVLGTMGIVFLNKCEAWVSNLRYQYMLRKKKNVLLQYNSGEDLA VNIIFPEKIDMTTFSKEAGDEEI
Download sequence
Identical sequences	F6QZD7 XP_001917597.1.31192 ENSECAP00000010092 9796.ENSECAP00000010092 ENSECAP00000010092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]