SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000010092 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000010092
Domain Number 1 Region: 209-247
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000042
Family EGF-type module 0.014
Further Details:      
 
Domain Number 2 Region: 89-132
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000124
Family EGF-type module 0.01
Further Details:      
 
Domain Number 3 Region: 167-207
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000419
Family EGF-type module 0.01
Further Details:      
 
Domain Number 4 Region: 131-175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000455
Family EGF-type module 0.017
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000010092
Domain Number - Region: 56-105
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00062
Family EGF-type module 0.054
Further Details:      
 
Domain Number - Region: 309-366
Classification Level Classification E-value
Superfamily CbiD-like 0.0157
Family CbiD-like 0.021
Further Details:      
 
Domain Number - Region: 30-58
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0965
Family EGF-type module 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000010092   Gene: ENSECAG00000012122   Transcript: ENSECAT00000012776
Sequence length 383
Comment pep:known chromosome:EquCab2:24:42604046:42611719:1 gene:ENSECAG00000012122 transcript:ENSECAT00000012776 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTATAALLPVLLLLLAFGRSAHGAECFPACHPQNGFCEDDNVCRCQPGWQGPLCDQCVTF
PGCVHGLCVEPWQCICDDGWDGNLCDLDIRACASTPCANNGTCVNLDSGHYECSCTPGFS
GQDCQKKDGPCAINGSPCQHGGSCVDDEGQASHASCLCLPGFSGNFCEIMTNSCIPNPCE
NQGICTDIGGDFRCRCPAGFMDKTCSRPVTTCTTDPCLNGGTCLQHSQVRYECLCKPEFT
GPLCGKKRVQSPQQVTRLPSGYGLTYRLTPGVHELPVPQPEHHILKVSMKELNKSTPLLS
EGQAVCFTILGVLTSLVVLGTMGIVFLNKCEAWVSNLRYQYMLRKKKNVLLQYNSGEDLA
VNIIFPEKIDMTTFSKEAGDEEI
Download sequence
Identical sequences F6QZD7
ENSECAP00000010092 9796.ENSECAP00000010092 ENSECAP00000010092 XP_001917597.1.31192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]