SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000010124 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000010124
Domain Number 1 Region: 967-1275
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 2.62e-91
Family Complement components 0.0000235
Further Details:      
 
Domain Number 2 Region: 1348-1473
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 1.23e-37
Family Alpha-macroglobulin receptor domain 0.00000202
Further Details:      
 
Domain Number 3 Region: 795-915
Classification Level Classification E-value
Superfamily E set domains 6.44e-32
Family SVA-like 0.014
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000010124
Domain Number - Region: 367-427
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.0589
Family Invasin/intimin cell-adhesion fragments 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000010124   Gene: ENSECAG00000012299   Transcript: ENSECAT00000012810
Sequence length 1475
Comment pep:known chromosome:EquCab2:6:36281944:36334282:-1 gene:ENSECAG00000012299 transcript:ENSECAT00000012810 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGNQLPNPVLILLFLLLPRDASATSKPQYLVLVPSQLYSGVPEKACILLNHLNETVTLS
VTLEYGRQSRNLLTDLVTEKNSFYCSPFIIPELPSASAFITVQVKGPTLQFINRKSVQIT
QAESLVFVQTDKPTYKPGQTVRFRIVSVDVSFHPLNEMFPVVYIENPKRNRIFQWQSLKL
QGGLSQLSLPLSAEPALGPYKVVLQKESGRKIEHSFEVIEYVLPKFEVQVKMPKTIGFLD
KEFVVSVCGLYTYGKPVSGLVTINICRKYSRYYSTCHGKHSQSICEEFSQQADNEGCFTQ
FVKTKIFQLRQKLYDMTIQVEAKVREEGTGLELTGHGSCEITNTLSKLKFIKVDSHYRCG
LPFFGQILLVDEKDKPIPNETIVVAVDLNRYRSSYTTNEHGLVDISIDTTNFTSSFITVT
VTYKENNQCFDHWWLSEFHTQAQHTAKRIFSPSKSYVRLEPVAGTMTCGQTQEIRAHYIL
NGQILQDEKDLTFYYLIQARGSISQSGIHVLSIKQGDMKGVFSFSFQVKSDNAPSAQLLV
YTILPNGEIVADTGTLEIENCFANKVNLSFSSARNLPASNTTLKVTATPHSLCALRAVDH
SVLLMKPEAELSPQSVYNLLPEKNLFSVSYRGPANEDGQKCIHAEDITHNGIIYTPKQIL
DDDDVYSIFEAKSVGLNIFTNSKIHKPRFCQLPHGYPAMPMPYLGGKVPQGLALASGAAG
AVYPTMMREEFPATEVKGTVRKYFPETWIWDLVPLDSSGGSELAKQVPDTITEWKANALC
LSKTTGLGLSPIISLQVFQPFFLELTLPYSVVRGEDFILKATVFNYLFHCIRVSVQLDIS
PAFSAVPVEKNEDSHCVCGNGQKTVSWAVTPKSPGKVNFTATAEALRSQELCGNEVPEVP
AFGQKDTVVKPLLVELEGIEKEETFNTLLCASETGVPEKLSLKVPSDVVKGSARATYSVL
GDILGSAMQNLQNLLQMPYGCGEQNMVLFVPNIYVLNYLSETQQLTEKIKSKAISHLISG
YQRQLNYKHSDGSYSTFGDHDGRSQGNTWLTAFVLKSFAQARSYIYVEDSHITNSLTWLS
QKQKENGCFQSSGLLLNNAIKGGVDDEVTLSAYITIALLEMPLPVTHQVVRNALFCLENA
WRSTSEAQGSLVYIKALLAYAFALAGNQAKRSELLESLDKEAVKEEDSIHWQRPGKFQEA
KELYYQPRAPSAEVEMTSYLLLAYLTAQPAPSSEDLSVASRIVKWITKQQNPNGGFSSTQ
DTVVALQALSKYGAATFTKREKEAIVTVKSSRTFSEEFQVDDTNRLLLQEVELPEIPGEY
STTVSGSGCVYLQTSLRYNILPKKEGKVPFTLKVDPLAKNCDGIDVHRKFQIHINISYTG
ERPSSNMVIVDVKMVSGFIPVKTSVKKLQERPQIQRTEVSTNHVLIYFEELTNQTLSFAF
SVEQCIQIKNLKPATVKAYDYYETEEFTIEEYSDP
Download sequence
Identical sequences F6REX3
ENSECAP00000010124 9796.ENSECAP00000010124 ENSECAP00000010124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]