SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000010125 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000010125
Domain Number 1 Region: 1218-1504
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.31e-52
Family Tandem AAA-ATPase domain 0.00021
Further Details:      
 
Domain Number 2 Region: 1007-1180
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 9.81e-47
Family Sec63 N-terminal domain 0.0014
Further Details:      
 
Domain Number 3 Region: 1513-1722
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.36e-46
Family Tandem AAA-ATPase domain 0.00099
Further Details:      
 
Domain Number 4 Region: 1842-2003
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 7.32e-44
Family Sec63 N-terminal domain 0.0000823
Further Details:      
 
Domain Number 5 Region: 484-654,683-737,775-871
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.79e-43
Family Tandem AAA-ATPase domain 0.00047
Further Details:      
 
Domain Number 6 Region: 2070-2180
Classification Level Classification E-value
Superfamily E set domains 1.4e-24
Family Sec63 C-terminal domain-like 0.00053
Further Details:      
 
Domain Number 7 Region: 1722-1824
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000209
Family RPO3F domain-like 0.069
Further Details:      
 
Domain Number 8 Region: 885-990
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000408
Family Forkhead DNA-binding domain 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000010125   Gene: ENSECAG00000012013   Transcript: ENSECAT00000012812
Sequence length 2201
Comment pep:known chromosome:EquCab2:10:51481055:51795374:-1 gene:ENSECAG00000012013 transcript:ENSECAT00000012812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALPRLTGALRSFSNVTKQDNYNEEVADLKMKRSKLHEQIVGLDLTWKKIVKFLNEKLET
SEMQSVNEDLKDILQAAKQIVGMDNGKEVIESAAAFLFQTFHLKDCVGHKETKAIKQMFG
PFPSSSATAACNATNRITSHFHQDSLTALVQMTKEENGDRVLFGKNLAFSFDMHDLDYFD
ELPINGESQKTISLDYKKFMNEHFQEHSTPGLKPVEKTNDSFLWCEVEKYLNATLNEMAE
ATRIEDLCCTLYDMLASVKSGDELQNELFELLGPDGLELIEKLLQNRITIVDRFLNSSND
HRLQALQDNCKKILGENAKPNYGCQVTIQSEQEKQLMKQYRREEKRIARREKKAGEDGEV
SEGLMCFDPKELRIQREQALLNARSGPILSRQRDTDIEKIRYPHVYDSQAEAMKTSAFIA
GAKMILPEGIQRENNKMYEEVKIPYSEPMPVGFEEKPVYIQDLDEIGQLAFKGMRRLNRI
QSIVFETAYNTNENMLICAPTGAGKTNIAMLTVLHEIRQHFQQGVIKKNEFKIVYVAPMK
ALAAEMTNYFSKRLEPLGIVVKELTGDMQLSKSEILRTQMLVTTPEKWDVVTRKSVGDVA
LSQIVKLLILDEVHLLHEDRGPVLESIVARTLRQVESTQSMIRILGLSATLPNYLDVATF
LHVNPCIGLFYFDGRFRPVPLGQTFLGVKSANKVQQLNNMDEVCYESVLKQVKAGHQVMV
FVHARNATVRTAMSLIERAKNNGQISCFLPSQGPEYGHAEKQVQKSRNKQVRELFPEGFS
IHHAGMLRQDRNLVENLFSNGHIKVLVCTATLAWGVNLPAHAVIIKGTQIYAAKRGSFVD
LGILDVMQIFGRAGRPQFDRFGEGIIITTHDKLSHYLTLLTQQNPIESQFLESLADNLNA
EIALGTVTNVEEAVKWISYTYLYVRMRANPLVYGISHKAYQIDPALTKHREQLVIEVGRK
LDKARMIRFEERTGYFSSTDLGRTASHYYIKYNTIETFNELFDAHKTESDILAIVSKAEE
FDQIKVREEEIEELDALLNNFCELSAPGGVENSYGKINILLQTYISRGEMDSFSLISDSA
YVAQNAARIVRALFEIALRKRWPAMTYRLLNLSKVIDKRLWGWASPLRQFPVLPPHILTR
LEEKNLTVDKLKDMRKDEIGHMLHHVNIGLKVKQCVHQIPSVTMEASIQPITRTVLRVTL
SICPDFTWSDQVHGTVGEPWWIWVEDPTNDHIYHSEYFIVLKKQVLSKEAQLLVFTIPIF
EPLPSQYYIRAVSDRWLGAEAVCIINFQHLILPERHPPHTELLDLQPLPVTALGCEAYEA
LYNFSHFNPVQTQIFHTLYHTDCNVLLGAPTGSGKTVAAELAIFRVFNKYPTSKAVYIAP
LKALVRERMDDWKVRIEEKLGKKVIELTGDVTPDMKSIAKADLIVTTPEKWDGVSRSWQN
RNYVKQVTILIIDEIHLLGEERGPVLEVIVSRTNFISSHTEKPVRIVGLSTALANARDLA
DWLNIHQMGLFNFRPSVRPVPLEVHIQGFPGQHYCPRMASMNKPTFQAIRSHSPAKPVLI
FVSSRRQTRLTALELIAFLATEEDPKQWLNMDEREMEDIIGTLRDSNLKLTLAFGIGMHH
AGLHERDRKTVEELFVNCKVQVLIATSTLAWGVNFPAHLVIIKGTEYYDGKTRRYVDFPI
TDVLQMMGRAGRPQFDDQGKAVILVHDIKKDFYKKFLYEPFPVESSLLGVLSDHLNAEIA
GGTITSKQDAMDYITWTYFFRRLIMNPSYYNLSDVSHDSVNKFLSNLVEKSLVELEHSYC
IEIGEDNRSIEPLTYGRIASYYYLKHQTVKMFKERLKPECGTEELLSILSDAEEYTDLPV
RHNEDHMNSELAKCLPFESNPHSFDSPHTKAHLLLQAHLSRTMLPCPDYDTDTKTVLDQA
LRVCQAMLDVAANQGWLVTVLNISNLVQMVVQGRWLKDSSLLTVPNIELHHLHIFRKWSS
GIKGPRAGCHGFIECLPELIHCGGKDHVFSSMMENELPAAKMKQAWNFLSRLPVIDVGLS
VKGWWDDSVEGHGELAITTLTSDKRDDNRWIRLHADQEYVLQVSLQRVHAGFHKGKQDSH
AVTPRFPKLKDEGWFLILGEVDKRELIALKRVGYIRNHHVVSISFYTPEVPGRYIYTLYF
MSDCYLGLDQQYDIHLNVTPASISAQVNEEVSDALTDLKVQ
Download sequence
Identical sequences F6REW3
ENSECAP00000010125 ENSECAP00000010125 9796.ENSECAP00000010125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]