SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000010139 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000010139
Domain Number 1 Region: 78-221
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 4.45e-24
Family Toll/Interleukin receptor TIR domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000010139   Gene: ENSECAG00000012390   Transcript: ENSECAT00000012827
Sequence length 224
Comment pep:known chromosome:EquCab2:7:35105295:35107741:1 gene:ENSECAG00000012390 transcript:ENSECAT00000012827 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSSSFPAPRSRSRKPLGKMADWFRQALSKKPKVPVSPESTPSDVSQPSSQDSNPPQCL
SSVVSPTPPPTNTGTSSSSSSSGRWSKDYDVCVCHSEQDLVAAQELVSYLEDSPAGLRCF
LQLRDATPGGAIVSELCQALSNSHCCVLLITPGFLQDPWCKYQMLQALTQSPGAEGCTIP
LLSGLTRAAYPAELRFMYFVDGQGPDHGFRQVKQAVMRYLQTLS
Download sequence
Identical sequences F6QQZ5
9796.ENSECAP00000010139 XP_001505147.1.31192 XP_005611754.2.31192 XP_008515315.1.77740 XP_014596761.1.31192 XP_014596762.1.31192 XP_014596763.1.31192 XP_014596764.1.31192 XP_014596765.1.31192 ENSECAP00000010139 ENSECAP00000010139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]