SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000010144 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000010144
Domain Number 1 Region: 1548-1652,1687-1830
Classification Level Classification E-value
Superfamily Cullin homology domain 2.22e-38
Family Cullin homology domain 0.0015
Further Details:      
 
Domain Number 2 Region: 1147-1303
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.17e-36
Family APC10-like 0.0049
Further Details:      
 
Domain Number 3 Region: 369-443
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 9.02e-32
Family CPH domain 0.0000147
Further Details:      
 
Domain Number 4 Region: 2233-2286
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000465
Family RING finger domain, C3HC4 0.0042
Further Details:      
 
Domain Number 5 Region: 2074-2159
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000848
Family RING finger domain, C3HC4 0.015
Further Details:      
 
Domain Number 6 Region: 149-198,540-561,692-770,991-1082
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000000669
Family Armadillo repeat 0.074
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000010144
Domain Number - Region: 1854-1955
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00154
Family SCF ubiquitin ligase complex WHB domain 0.065
Further Details:      
 
Domain Number - Region: 2146-2214
Classification Level Classification E-value
Superfamily RING/U-box 0.00388
Family IBR domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000010144   Gene: ENSECAG00000011751   Transcript: ENSECAT00000012837
Sequence length 2525
Comment pep:known chromosome:EquCab2:20:42197772:42230808:1 gene:ENSECAG00000011751 transcript:ENSECAT00000012837 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGERRTGDLMVPLGPRLQAYPEELIRQRPGHDGRPEYLIRWSVLKCGEVGRVGVEEGKA
EHILMWLSAPEVYANCPMLLGEPAVSKGPQHEPAGGSGSFPRDPGGLDDVAMGEMEADVR
ALVRRAARQLAEGGTSSLTATVLHTIHVLSAYASIRPLTGVFRETGALDLLMHMLCNPEP
QIRRSAGKMLQALAAHDAGSRAHVLLSLSQQDGIEQHMDFDSRYTLLELFAETTSSEEHC
MAFEGIHLPQIPGKLLFSLVKRYLCVTSLLDKLNNSPEPGTGDRGSPSPREFSQEKSRGQ
RELEFSMAVGNLISELVRSMGWTRNLSEQGTSPPRPTRSIFQPCISGPSLLLPTIVATPR
RQGRAFRQRSEFSSRSGYGEYVQQTLRPGMRVRMLDDYEEISAGDEGEFRQSNNGVPPVQ
VFWQSTGRTYWVHWHMLEILGPEEAAEDRASAAVEKGAGATMLGTALPSWDWKPVDGLYS
LPYLQPEPQKKEELGYLTQAEWWELLFFIKKLDVCEQQSIFQNLRENLDESLSEKALGET
SVPIEMAEGLLQVLSNRFEGSTLSDLLNSQIYTKYGLLPDEPSSSSSSRSHSCTPDAEEE
SKSEVTFSGEEAESLKAKAEPPKAEAESAKGKTEPPMAQSDSQLFNQLLVTEGMALSPEM
KEAAREMARALRGPGPRSSLDQHVAAVVATVQISSLDTNLQLSGLYALSQAVEEVTERDH
PLVHPDRSLREKIVKTLVELLTSQVGEKMVVVLALRLLYLLVTKHEWRPLFAREGGIYAV
LVCMQEHKTSVLVQQAGLAALKMMAIASSSEIPTFVTGRESIHPLFDAQMTREIFASIDS
ATRPGSESLLLTLPAAVILMLNTEGCSSAVRNGLLLLNLLLCNHHTLGDHIITRELRDTL
FRHSGIAPGTEPMPTTHTILMMLLNRYSEPPGSPEHTATLETPSVQGLDGSPELLIRSLV
GGPSAELLLDLERVLCRESGPGGAVRPLLKRLQQETQPFLLLLRTLDAPGPNKTLLLTAL
RVMTRLLDHSEAMVLPWHEVLEPCLNCLSGPSSDSEIVQELLCFLHRLASMHKDYAVVLC
CLGAKEALSKVLDKHSAQLVLACELRDLVTECEKHAQLYSNLTSSILAGCIQMVLGQIED
HRRTHRPINIPFFDVFLRHLCQGSSVEVKEEKCWEKVEVSSNPHRASKLTDRNPKTYWES
NGSTGSHYITLHMHRGVLIRQLTLLVASEDSSYMPARVVVFGGDNTSCISTELNTVNVMP
SASRVILLENLNRFWPIIQIRIKRCQQGGIDTRVRGVEVLGPKATFWPLFREQLCRRTCL
FYTIRAQAWSQDIAEDRKRLLQLCPRLNRVLRHEQNFADRFLPDDEAAQALGKTCWEALV
SPLVQNITSPDAEGVSSLGWLLDQYLEHRESSRNPLSRAASFASRVRRLCHLLVHVEPPP
GPSPEPSTRPFSKNSKGRDRSPVPSPVLPSSSLRNITQCWLSVVQEQVSRFLAAAWRAPD
FVPRYCELYEHLQRAGSELFGPRAAFTLALRSGFSGALLQQSFLTAAHMSEQFARHIDQQ
IQGGLMGGAPGVEVLGRLQRHLEPIMVLSGLELATTFEHFYQHYMADRLLSLGSRWLEGA
VLEQIGLCFPNRLPQQMLRSLSTSEELQRQFHLFQLQWFDKLLLDKEDDEEQGLEEDEVR
AREKKEAEKELFIEDPSPAVSVLVLSPRCWPVSPLCYMYHPRKCLPTELCDALDCFSNFY
SQSQNHPVLDMGPHRRLKWTWLGRAELHFGDQTLHVSTVQMWLLLNFNQMEEVSVETLLK
SSLTPELLLQALLPLTSENGPLTLHEGPDFPHRGVLRLREPRLQPRGEALWLIPPQTYLN
VEKDEGRTLEQKRNLLSCLLVRILKAHGEKGLHIDQLVCLVLEAWQKGPNPPGSLGCAVA
GGVPCTSTDVLSCILHLLGQGYVERRDDRPQILMYATPEPMGPCRGQAEVPFCGTQTTKT
SKPSPEAVAALASLQLPAGRTMSPQEVEGLMEQTVRQVQETLNLEPDVAQHLLAHSHWGA
EQLLQSYSDNPEPLLLAAGLCVPQAQAAPARPDHCPVCVSTLEPDDDLPSLCCMHYCCKS
CWNEYLTTRIEQNLVLNCTCPIADCPAQPTGAFIRAIVSSPEVISKYEKALLRGYVESCS
NLTWCTNPQGCDRILCRQGLGCGTTCSKCGWASCFNCSFPEAHYPASCGHMSQWVDDGGY
YDGMSVEAQSKHLAKLISKRCPSCQAPIEKNEGCLHMTCAKCNHGFCWRCLKSWKPNHKD
YYNCSAMVSKAARQEKRFQDYNERCTFHHQARVFAVNLRNRVSAIHEVPPPKSFTFLSDA
CRGLEQARKVVLAYACVYSFYNQDTEHMDVVEQQTENLELHTNALQILLEETLLRCRDLA
SSLRLLRADCLNTGLELLRRIQERLLAILQHSAQDFRVGLQSPSSEAWEAKGSNTPGHQP
QGSSGLEVEEEEEEEDDEEDVPEWQQDEFDEELDNDSFSYDEESENLDRETFFFGDEEDD
DDAYD
Download sequence
Identical sequences F6QQI1
ENSECAP00000010144 9796.ENSECAP00000010144 ENSECAP00000010144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]