SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000010161 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000010161
Domain Number 1 Region: 595-895
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.91e-83
Family Protein kinases, catalytic subunit 0.0000000000911
Further Details:      
 
Domain Number 2 Region: 1-175
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.02e-76
Family Ephrin receptor ligand binding domain 0.0000000123
Further Details:      
 
Domain Number 3 Region: 892-966
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.95e-21
Family SAM (sterile alpha motif) domain 0.0000338
Further Details:      
 
Domain Number 4 Region: 304-416
Classification Level Classification E-value
Superfamily Fibronectin type III 4.97e-16
Family Fibronectin type III 0.0025
Further Details:      
 
Domain Number 5 Region: 233-304,342-361
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000393
Family Growth factor receptor domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000010161   Gene: ENSECAG00000011631   Transcript: ENSECAT00000012858
Sequence length 968
Comment pep:known chromosome:EquCab2:2:31851913:31952745:-1 gene:ENSECAG00000011631 transcript:ENSECAT00000012858 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ETLMDSTTATAELGWIVHPPSGWEEVSGYDENMNTIRTYQVCNVFESSQNNWLRTKFIRR
RGAHRIHVEMKFSVRDCSSIPSVPGSCKETFNLYYYEADFDSATKTFPNWMENPWVKVDT
IAADESFSQVDLGGRVMKINTEVRSFGPVSRSGFYLAFQDYGGCMSLIAVRVFYRKCPRI
IQNGAIFQETLSGAESTSLVAARGSCIANAEEVDVPIKLYCNGDGEWLVPIGRCMCKAGF
EAVENGTVCRGCPSGTFKANQGDEACAHCPINSRTTSEGATNCVCRNGYYRADLDPLDMP
CTTIPSAPQAVISSVNETSLMLEWTPPRDSGGREDLVYNIICKSCGSGRGACTRCGDNVQ
YAPRQLGLTEPRIYISDLLAHTQYTFEIQAVNGVTDQSPFSPQFASVNITTNQAAPTIIS
ISQATGRKKESEKESWSSRKETKARFLEDALVQVQETHAQKGCALIGGSRSPVMVQTLED
AGTIWKEAAGARQVGLAGLCSIWVLFRVQREAAEGRQQSEVVREAAGSQRPGLGFHVHST
VLLIIVLEQLSFKGSDSEYFRLCRPYAAGELTPGMKIYIDPFTYEDPNEAVREFAKEIDI
SCVKIEQVIGAGEFGEVCSGHLKLPGKREIFVAIKTLKSGYTEKQRRDFLSEASIMGQFD
HPNVIHLEGVVTKSTPVMIITEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLA
DMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDTSDPTYTSALGGKIPIRWTAPEAI
QYRKFTSASDVWSYGIVMWEVMSYGERPYWDMTNQDVINAIEQDYRLPPPMDCPSALHQL
MLDCWQKDRNHRPKFGQIVNTLDKTIRNPNSLKAVAPLSSGINLPLLDRTIPDYTSFNTV
AEWLEAIKMGQYKESFANAGFTSFDVVSQMVMEDILRVGVTLAGHQKKILNSIQVMRAQM
NQIQSVEV
Download sequence
Identical sequences F6RYY0
9796.ENSECAP00000010161 ENSECAP00000010161 ENSECAP00000010161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]