SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000010199 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000010199
Domain Number 1 Region: 123-303
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.95e-41
Family CBM11 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000010199   Gene: ENSECAG00000012378   Transcript: ENSECAT00000012903
Sequence length 328
Comment pep:known chromosome:EquCab2:1:147316448:147329543:1 gene:ENSECAG00000012378 transcript:ENSECAT00000012903 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALVHKLLNGTCILRKCPKPSVASYPFLGTRFADYCSSSLQKPAPVPGKASSQRKTEGDL
QGHHQRDVALDITCPEEKPEVSFDKAIKDELKNHFWRLKDDIVNRWIGPEGRPLHEVLLE
QARVVWKFRGKEDLDKWIVTSDKTIGGRSEAFLKMGKNNQSALLYGTLSSDTPQDGESSR
SGYCAMISRIPRGPFERKRSYDWSQFNTLYLRVRGDGRPWMVNIREDTDIIQRKNQMYSY
FMFTRGGPYWQDVKIPFSKFFFSNQGRIRDAQYQLLLDKISSIGFTLADKVDGPFFLEID
FIGVFTDPAHTEEFAYENSPELNPRLFK
Download sequence
Identical sequences F6R7D5
ENSECAP00000010199 XP_001503486.1.31192 XP_005603185.1.31192 XP_008537961.1.77740 XP_008537968.1.77740 9796.ENSECAP00000010199 ENSECAP00000010199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]