SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000010222 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000010222
Domain Number 1 Region: 166-334
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.14e-41
Family SPRY domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000010222   Gene: ENSECAG00000012440   Transcript: ENSECAT00000012929
Sequence length 337
Comment pep:known chromosome:EquCab2:25:18270455:18284215:1 gene:ENSECAG00000012440 transcript:ENSECAT00000012929 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQNKIVDQCERLQLQSAGITKYVAEVLPGKNQRAVSTASAARELVIQRLGLVRSLCESEE
QRLLEQVHGEEERAHQSILTQRAHWADALQKLDTIRTSLVDMLTHLDDLQLIQKEQEIFE
RTEEAEGILDPQESEKLNFNEKCTLSPLLTQLWATAVLRSLSGTEDVRIDERTASPLLQL
SDDRRTLTFNAKKSKACADGLERFDHWPNALAATSFQAGLHAWTVNVQNSCAYKVGVALV
QLPRKGSGSDSRLGHNAFSWVFSRYDQEFCFSHNGQHEPLRLLRCPAQLGVLLDLQAQEL
LFYEPASGTVLHTHHAAFPGPLFPVFAVADQTISIVH
Download sequence
Identical sequences F6SYN3
ENSECAP00000010222 ENSECAP00000010222 9796.ENSECAP00000010222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]