SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000010236 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000010236
Domain Number 1 Region: 38-176
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.19e-40
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00065
Further Details:      
 
Domain Number 2 Region: 150-336
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.22e-39
Family Laminin G-like module 0.0061
Further Details:      
 
Domain Number 3 Region: 569-591,794-957
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.19e-35
Family Laminin G-like module 0.0021
Further Details:      
 
Domain Number 4 Region: 351-519
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.61e-34
Family Laminin G-like module 0.0055
Further Details:      
 
Domain Number 5 Region: 967-1171
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.37e-30
Family Laminin G-like module 0.0075
Further Details:      
 
Domain Number 6 Region: 576-635
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.00000000916
Family Fibrinogen C-terminal domain-like 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000010236   Gene: ENSECAG00000017885   Transcript: ENSECAT00000012945
Sequence length 1306
Comment pep:known chromosome:EquCab2:18:6478638:6494869:-1 gene:ENSECAG00000017885 transcript:ENSECAT00000012945 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSVPRLTSVFTLLFSGLWHLGLTATNYNCDDPLASLLSPMAFSSSSDLTGTHSPAQLNR
RVGTGGWSPADSNAQQWLQMDLGNRVEITAVATQGRYGSSDWVTSYSLMFSDTGRNWKQY
KQEDSIWTFAGNMNADSVMHHKLLHSVRARFVRFVPLEWNPSGKIGMRVEVYGCSYKSDV
ADFDGRSSLLYRFNQKLMSTLKDVISLKFKSMQGDGVLFHGEGQRGDHITLELQKGRLAL
HLNLDDSKLRLSSSPPSATLGSLLDDQHWHSVLIERVGKQVNFTVDKHTQHFRTKGEADA
LDIDYELSFGGIPVPGKPGTFLKKNFHGCIENLYYNGVNIIDLAKRRKHQIYTGNVTFSC
SEPQIVPITFVNSSSSYLLLPGTPQIDGVSVSFQFRTWNKDGLLLSTELSEGSGTLLLSL
EGGTLRLVIQKVTERAAEILTGGNLHDGLWHSVSITARRNRITLTLDNKAAFPTQDTSRV
QIYSGNSYYFGGCPDNLTDSQCLNPIKAFQGCMRLIFIDNQPKDLISVQQGSLGNFSDLH
IDLCSIKDRCLPNYCEHGGSCSQSWTTFYCNCSDTGYTGATCHNSIYEQSCEVYRHQGNT
AGFFYIDSDGSGPLAPLQVYCNITEDKIWTSVQHNNTELTHVRGTDPENPYTMTLDYGSS
MEQLEAVIDGSEHCEQEVAYHCRKSRLLNTPDGTPFTWWIGRSNERHPYWGGVPPGVQQC
DCGLDESCLDIQHFCNCDADKDEWTNDTGFLSFKDHLPVTQIVITDTNRSNSEAAWRIGP
LRCYGDRHFWNAVSFYTEASYLHFPTFHAEFSADISFFFKTTALSGVFLENLGIKDFIRL
EISSPSEITFAIDVGNGPVELVVQSPSLLNDNQWHYVRAERNLKETSLQVDSLPRMTKET
SEEGHFRLQLNSQLFVGGTSSRQKGFLGCIRSLHLNGQKLDLEERAKVTSGVRPGCPGHC
SSYGSICHNGGQCVEKHSGYFCDCTNSPYEGPFCKKEVSAVFESGTSVTYMFQEPYPVTK
NISLSSSAIYADAAPSKENIAFSFVTAQAPSLLLYINSSSQDFLAVLLCKNGSLQVRYQL
SKGEIHVFTIDVENFANRRMHRLKINREGRELTIQMDQQLRLSYNFSPEVEFRAIRSLTL
GKVTENLGLDTEVAKANAMGFIGCLSSVQYNHIAPLKAALRHATIAPVTIQGTLTESSCG
SIVNSDVNAVTTVHSSSDPFGKTDEKEPLTNAVRSDSAIIGGVIAVVIFIIFSIIGIMTR
FLYQHKQSHRTNQMKEKEYPENLDSSFRNDIDLQNTVSECKREYFI
Download sequence
Identical sequences F6QSR8
ENSECAP00000022874 9796.ENSECAP00000022874 ENSECAP00000010236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]