SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000010251 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000010251
Domain Number 1 Region: 140-258
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.07e-17
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 2 Region: 244-300
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000000617
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 3 Region: 15-70,112-168
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000235
Family Growth factor receptor domain 0.016
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000010251
Domain Number - Region: 286-331
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000776
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000010251   Gene: ENSECAG00000012066   Transcript: ENSECAT00000012964
Sequence length 448
Comment pep:known chromosome:EquCab2:24:34970448:35044414:-1 gene:ENSECAG00000012066 transcript:ENSECAT00000012964 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGLKRILTVTILALCLPCPGNAQQQCTNGFDLDRPSGQCLDIDECRTIPEACRGDMMCV
NQNGGYLCIPRTNPVYRGPYSNPYSNPYSGPYPAAAPPLSAPNYPTISRPLICRFGYQMD
ESNQCVDVDECATDSHQCNPTQICINTEGGYTCSCTDGYWLLEGQCLDIDECRYGYCQQL
CANVPGSYSCTCNPGFTLNEDGRSCQDVNECATENPCVQTCVNTYGSFICRCDPGYELEE
DGIHCSDMDECSFSEFLCQHECVNQPGTYFCSCPPGYILLDDNRSCQDINECEHRNHTCI
LQQTCYNLQGGFKCIDPIRCEEPYLRISDNRCMCPAENPGCRDQPFTILYRDMDVVSGRS
VPADIFQMQATTRYPGAYYIFQIKSGNEGREFYMRQTGPISATLVMTRPIKGPRDIQLDL
EMITVNTVINFRGSSVIRLRIYVSQYPF
Download sequence
Identical sequences F6SRH3
ENSECAP00000010251 9796.ENSECAP00000010251 ENSECAP00000010251 XP_001494645.2.31192 XP_008528417.1.77740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]