SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000010424 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000010424
Domain Number 1 Region: 570-633
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000032
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 2 Region: 498-544
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000366
Family TSP-1 type 1 repeat 0.00089
Further Details:      
 
Domain Number 3 Region: 625-681
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000639
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 4 Region: 25-72
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000196
Family TSP-1 type 1 repeat 0.0021
Further Details:      
 
Domain Number 5 Region: 77-118
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000589
Family LDL receptor-like module 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000010424
Domain Number - Region: 450-488
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0077
Family EGF-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000010424   Gene: ENSECAG00000012362   Transcript: ENSECAT00000013161
Sequence length 842
Comment pep:known chromosome:EquCab2:21:25231954:25274655:-1 gene:ENSECAG00000012362 transcript:ENSECAT00000013161 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QAISLLILVGFIGEFQVFSSASSPINCQWASYGPWSECSGCTKTQTRRRSIAVYGQYGGH
PCVGSAFETQSCEPTRGCPTEEGCGERFRCFSGQCISKSLVCNGDSDCEEDSADEDRCED
SESRPSCDLDKPPPNIELTGNGYNALTGQFKNRVINTKSFGGQCRKVFSGDRKDFYRLSG
NILSYTFQVKIDNDFNYEFYNSSWSYVKHTSTERTSSSRRRFFFSSSSSSSHSYTSHKDE
IHNKKSYQLLVIQNTVEVAQFINNNPEFLQLAEPFWKELSYLPSLYDYSAYRRLIDRYGT
HYLQSGSLGGEYKVLFYVDSEKMKQSGISSADEMECTSSDVNLIFKSSKHKCQALKEALK
SAAGTEGNVLRGKPFVRGGSAGFVSGLSYLELDNPAGNKNRYSSWAGSVTDLPQVIKQKL
TPLYELVKEVPCASVKRLYLKRALEEYLDEFDPCHCQPCQNGGIATVEGTQCQCHCKPYT
FGVACEQGVLVGDQAGGVDGDWSCWSSWGPCVQGKKTRRRECNNPPPSRGGKSCIGETSE
SRQCEDEELKHFRLLEPHCFPLSLVPTEFCSSPPALKDGFVQDEGAMFPVGKNIVYTCNE
GYSLVGDPVARCGEDLQWLVGKMHCQKIACVLPALTDGIQSHPHKPFYTVGEKVTFSCSG
GMSLEGPSAFLCGSSLKWSPEIKNVRCVQKGAPSTHTVPACQRWEKLKNSRCVCKMPYEC
GSSLDVCARDEKTKRILPLTVCKMHVLRCQGRNYTLTGRESCSLPASAEKACGVCPLWGK
CDDQSSKCVCREASECEEEGFSVCVEVNGKEQTMTECEAGTLRCGGQSISVTSITPCAAG
TQ
Download sequence
Identical sequences F6Q7J3
ENSECAP00000010424 9796.ENSECAP00000010424 ENSECAP00000010424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]