SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000010488 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000010488
Domain Number 1 Region: 497-682,890-1029
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 4.1e-59
Family Regulator of chromosome condensation RCC1 0.012
Further Details:      
 
Domain Number 2 Region: 3719-3909
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.62e-27
Family APC10-like 0.015
Further Details:      
 
Domain Number 3 Region: 2229-2272,2354-2397
Classification Level Classification E-value
Superfamily E set domains 0.00000000527
Family Filamin repeat (rod domain) 0.012
Further Details:      
 
Domain Number 4 Region: 4463-4538
Classification Level Classification E-value
Superfamily RING/U-box 0.000000023
Family RING finger domain, C3HC4 0.019
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000010488
Domain Number - Region: 3683-3748,4030-4109
Classification Level Classification E-value
Superfamily ARM repeat 0.00279
Family Armadillo repeat 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000010488   Gene: ENSECAG00000011696   Transcript: ENSECAT00000013234
Sequence length 4715
Comment pep:known chromosome:EquCab2:17:49874875:50130774:-1 gene:ENSECAG00000011696 transcript:ENSECAT00000013234 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVPEGSVAAAGLRLGLPVADSRGHYQLLLSGRALADRYRRIYTAALSDRDQGGSSAGHP
ASRNKKILNKKKLKRKQKSKSKVKTRSKSENLENTVIIPDIKLHSNPSAFNIYCNVRHCV
LEWQKKETSLAAASKNSVQSGESDSDEEEESKEPPIKLPKIIEVGLCEVFELIKETRFSH
PSLCLRSLQALLNVLQGQQPEGLQSEPPEVLESLFQLLLEITVRSTGMNDSTGQSLTALS
CACLFSLVASWGETGRTLQAISAILTNNGSHACQTIQVPMILNSLQRSVQAVLVGKIQIQ
DWFSNGIKKAALMHKWPLKEISVDEDDQCLLQNDGFFLYLLCKDGLYKIGSGYSGTVRGH
IYNSTSRIRNRKEKKSWLGYAQGYLLYRDVNNHSMTAIRISPETLEQDGTVMLPDCHTEG
QNILFTDGEYINQIAASRDDGFVVRIFATSTEPVLQQELQLKLARKCLHACGISLFDLEK
DLHIISTGFDEESAVLGAGREFALMKTANGKIYYTGKYQSLGIKQGGPSAGKWVELPITK
SPKIVHFSVGHDGSHALLVAEDGSIFFTGSASKGEDGESTKSRRQSKPYKPKKIIKMEGK
IVVYTACNNGSSSVISKDGELYMFGKDAIYSDSSSLVTDLKGHFVTQVAMGKAHTCVLMK
NGEVWTFGVNNKGQCGRDTGAMNQGGKGFGVENMATAMDEDLEEELDEKDEKSMMCPPGM
HKWKLEQCMVCTVCGDCTGYGASCVSSGRPDRVPGGICGCGSGESGCAVCGCCKACAREL
DGQEARQRGILDAVKEMIPLDLLLAVPVPGVNIEEHLQLRQEEKRQRVIRRHRLEEGRGP
LVFAGPIFMNHREQALARLRSHPAQLKHKRDKHKDGSGERGEKDASKITTYPPGSVRFDC
ELRAVQVSCGFHHSVVLMENGDVYTFGYGQHGQLGHGDVNSRGCPTLVQALPGPSTQVTA
GSNHTAVLLLDGQVFTFGSFSKGQLGRPILDVPYWNAKPAPMPNIGSKYGRKATWIGASG
DQTFLRIDEALINSHVLATSEIFASKHIIGLVPASISEPPPFKCLLINKVDGSCKTFNDS
EQEDLQGFGVCLDPVYDVIWRFRPNTRELWCYNAVVADARLPSVADMQSRCSILSPELAL
PTGSRALTTRSHAALHILGCLDTLATMQDLKMGVASTEEETQAVMKVYSKEDYSVVNRFE
SHGGGWGYSAHSVEAIRFSADTDILLGGLGLFGGRGEYTAKIKLFELGPDGGDHETDGDL
LAETDVLAYDCAAREKYAMMFDEPVLLQAGWWYVAWARVSGPSSDCGSHGQASITTDDGV
VFQFKSSKKSNNGTDVNAGQIPQLLYRLPTSDGSASKGKQQTSEPVHILKRSFARTVSVE
CFESLLSILHWSWTTLVLGVEELRGLKGFQFTATLLDLERLRFVGTCCLRLLRVYTCEIY
PVSATGKAVVEETSKLAECIGKTRTLLRKILSEGVDHCMVKLDNDPQGYLSQPLSLLEAV
LQECHNTFTACFHSFYPTPALQWACLCDLLNCLDQDIQEANFKTSSSRLLAAVMSALCHT
SVKLTSIFPIAYDGEVLLRSIVKQVSTENDSTLVHRFPLLVAHMEKLSQNEENISGMTSF
REVLEKMLVIVVLPVRNSLRRENELFSSHLVSNTCGLLASIVSELTASALGSEVDGLNSL
HSVKASANRFTKTSQGRSWNTGNGSPDAICFSVDKPGIVVVGFSVYGGGGIHEYELEVLV
DDSEHAGDSTHSHRWTSLELVKGTYTTDDSPSDIAEIRLDKVVPLKENVKYAVRLRNYGS
RTANGDGGMTTVQCPDGVTFTFSTCSLSSNGTNQTRGQIPQILYYRSEFDGDLQSQLLSK
ANEEDKNCSRALSVVSTVVRAAKDLLHRALAVDADDIPELLSSSSLFSMLLPLIIAYIGP
VAAAIPKVAVEVFGLVQQLLPSVAILNQKYAPPAFNPNQSTDSTTGNQPEQGLSACTTSN
HYAVIESEHPYKPACVMHYKVTFPECVRWMTIEFDPQCGTAQSEDVLRLLIPVRTVQNSG
YGPKLTSVHENLNSWIELKKFSGSSGWPTMVLVLPGNEALFSLETASDYVKDEKASFYGF
KCFAIGYEFSPGPDEGVIQLEKELANLGGVCAAALMKKDLALPIGNELEEDLEILEEAAL
QVCKTHSGILGKGLALSHSPTILEALEGNLPLQIQSNEQSFLDDFIACVPGSSGGRLARW
LQPDSYADPQKTSLILNKDDIRCGWPTTITVQTKDQYGDVVHVPNMKVEVKAVPVSQKKT
SLQQEQGKKPQRIPGSPAVTAASSNTDMTFGGLASPKLDVSYEPMIVKEARYIAITMMKV
YENYSFEELRFASPTPKRPSENMLIRVNNDGTYCANWTPGAIGLYTIHVTIDGIEIDAGL
EVKVKDPPKGMIPPGTQLVKPKTEPQPNKVRKFVAKDSAGLRVRSHPSLQSEQIGVVKVN
GTITFIDEIHNDDGVWLRLNDETIKKYVPNMNGYTEAWCLSFNQHLGKSLLVPVDNIFNA
SQGVRDLDVFSWTSKAFFPQEPKTNTDDFFKDINSCCPQEATMQEQDMPFLRGGPGMYKV
VKTGPSGHNIRSCPNLRGIPIGMLVLGNKVKAVGEVTNSEGTWVQLDKNSMVEFCESDEG
EAWSLARDRGGNQYLRHEDGNFLLDQNAQTPPPSPFSVQAFNKGATCSAQGFDYGLGNNK
GDQLSAILNSIQSRPNLPAPSIFDQAAKPPSSLVHSPFVFGQPLSFQQPQLQSDRGTIST
SSRPVSTSGKLELSSKHSRTLKPDGRMSRTTADQKKPRGTEGLSASESLMLKSDAAKLRS
DSHSRSLSPNHNTLQTLKSDGRMSSSFRAESPGPGSRSSSPKPKTLPTNRSSPSGASSPR
SSSPHDKNLPQKSTAPVKTKLDPPRERSKSDSYTLDPDTLRKKKMPLTEPLRGRSTSPKP
KPVPKDPKESPGSNNRAPSPHVVQVNLHSEVEACTSSTLKTNSLTDSTCDESSEFKSVDE
GSNKVHFSIGKAPLKDEQEMRASPKISRKCANRHTRPKKEKSSFLFKGDGSKPLEPAKQA
MSPSVAECARAVFASFLWHEGIVHDAMACSSFLKFNPELSKEHAPIRSSLNSQQPTEEKE
TKLKNRHSLEISSALNMFNIAPHGPDISKMGSINKNKVLSMLKEPPLHEKCEDGKTEATF
EMSMHHPMKSKSPLPLTLQHLVAFWEDISLATIKAASQNMIFPSPGSCAVLKKKECEKEN
KKAKKEKKKKEKTEVRPRGNLFGEMAQLAVGGPEKDTICELCGESHPYPVTYHMRQAHPG
CGRYAGGQGYNSIGHFCGGWAGNCGDGGIGGSTWYLVCDRCREKYLREKQAAAREKVKQS
RRKPMQVKTPRALPTMEAHQVIKANALFLLSLSSAAEPSILCYHPAKPFQSQLPSVKEGI
SEDIPVKMPCLYLQTLARHHHENFVGYQDDNLFQDEMRYLRSTSVPAPYISVTPDASPNV
FEEPESNMKSMPPSLETSPITDTDLAKRTVFQRSYSVVASEYDKQHSILPARVKAIPRRR
VNSGDTVGSSLLRHPSPELSRLISAHSSLSKGERNFQWPVLAFVIQHHDLEGLEIAMKQA
LRKSACRVFAMEAFNWLLCNVIQTTSLHDILWHFVASLTPAPVETEEEEDEENKTNKENA
EQEKDTRVCEHPLSDIVIAGEAAHPLPHTFHRLLQTISDLMMSLPSGSSLQQMALRCWSL
KFKQSDHQFLHQSNVFHHINNILSKSDDGDSEESFSISIQSGFEAMSQELCIVMSLKDLT
SIVDIKTSSRPAMIGSLTDGSTETFWESGDEDKNKTKNITINCVKGINARYVSIHVDNSR
DLGNKVTSMTFLTGKAVEDLCRIKQVDLDSRHIGWVTSELPGGDNHIIKIELKGPENTLR
VRQVKVLGWKDGESTKIAGQISASVAQQRNCEAETLRVFRLITSQVFGKLISGDAEPTPE
QEEKALLSSPEGEEKVYNATSDADLKEHMVGIIFSRSKLTNLQKQVCAHIVQAIRMEATR
VREEWEHAISSKENANSQPNDEDASSDAYCFELLSMVLALSGSNVGRQYLAQQLTLLQDL
FSLLHTASPRVQRQVTSLLRRVLPEVTPNRLASIIGVKSLPPADISDIIHSTEKGDWNKL
GILDMFLGCIAKALTVQLKAKGTTITGTAGTTVGKGVTTVTLPMIFNSSYIRRGESHWWM
KGSTPTQISEIIIKLIKDMAAGHLSEAWSRVTKNAIAETIIALTKMEEEFRSPVRCIATT
RLWLALASLCVLDQDHVDRLSSGRWMGKDGQQKQMPMCDNHDDGETAAIILCNVCGNLCT
DCDRFLHLHRRTKTHQRQVFKEEEEAIKVDLHEGCGRTKLFWLMALADSKTMKAMVEFRE
HTGKPTTSSSEACRFCGSRSGTELSAVGSVCSDADCQEYAKIACSKTHPCGHPCGGVKNE
EHCLPCLHGCDKNATSLKQDADDMCMICFTEALSAAPAIQLDCSHVFHLQCCQRVLENRW
LGPRITFGFISCPICKNKINHIVLKDLLDPIKELYEDVRRKALMRLEYEGLHKSEAITTP
GVRFYNDPAGYAMNRYAYYVCYKCRKAYFGGEARCDAEAGQGDDYDPRELICGACSDVSR
AQMCPKHGTDFLEYKCRYCCSVAVFFCFGTTHFCNACHDDFQRMTSIPKEELPHCPAGPK
GKQLEGTECPLHVVHPPTGEEFALGCGVCRNAHTF
Download sequence
Identical sequences F6PQ04
9796.ENSECAP00000010488 ENSECAP00000010488 ENSECAP00000010488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]