SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000010498 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000010498
Domain Number 1 Region: 611-788
Classification Level Classification E-value
Superfamily vWA-like 2.62e-54
Family Integrin A (or I) domain 0.00059
Further Details:      
 
Domain Number 2 Region: 426-609
Classification Level Classification E-value
Superfamily vWA-like 5.11e-47
Family Integrin A (or I) domain 0.00068
Further Details:      
 
Domain Number 3 Region: 15-202
Classification Level Classification E-value
Superfamily vWA-like 1.34e-41
Family Integrin A (or I) domain 0.0019
Further Details:      
 
Domain Number 4 Region: 215-405
Classification Level Classification E-value
Superfamily vWA-like 7.79e-40
Family Integrin A (or I) domain 0.0017
Further Details:      
 
Domain Number 5 Region: 797-836
Classification Level Classification E-value
Superfamily vWA-like 0.000032
Family Integrin A (or I) domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000010498   Gene: ENSECAG00000012733   Transcript: ENSECAT00000013245
Sequence length 837
Comment pep:known chromosome:EquCab2:16:66449133:66467296:1 gene:ENSECAG00000012733 transcript:ENSECAT00000013245 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLNNLLVLVCCHFILTEPGPQYADLVFLLDSSDHLGTKSFPFVKTFITKLISSLPIEANK
YRVALAQYSDTFHSEFQLGTFKSRNPMLNHLKKNFNFIGGSLRIGNALQEAHRTYFSGRA
NGRDKKEFPPILVVLASAKSEDDVEEASKALRRDGVRIISVGVQKASEENLKAMATAQFH
FNLRTVRDLSTFSQNMTQIIKDAAQYKEGEDDTDIEACGNSLADVVFMVDESLGTRENLR
NLQNFLKSITTSLDVKDNCMRIGLMSYSNRAKTISSLKSSTTQSEFLEQIQKLSLQAGKS
NAGAAIDMMRREAFSESSGSRRAQGVPQIAVLVTNRPSDDEVREAAQKLLREDVIVFAMS
IQGANNTQLEEIVSYPSRQRVSTLKSYADLERYSRIFQKKLQNEIWDQISTRAEQRNLDE
TGCLDTKEADLYFLIDGSTSIQNEQFEQIKRFMLEVTEVFSIGPGRVQVGVVQYSHEIRE
EFSIGVYSNDVDLRKAVLNIKQLTGDTHTGAALAFMLPKIREGRKQRPSKVPCYLIVLTD
GQSQDHHRILETANRIRAEGVTIHAVGIGEADKTELQQIAGNEERVHFGQNFDSLKSIKS
EVVHSICTEKGCEDMKADIMFLVDSSGSIGPENFGKMKTFMKNLLAKIQIGPDKTQIGVV
QFSTDAKEEFQLNKYFTQKEISDAIDRMSLINQNTYTGHALEFVDQYFSHLKGARPGVKK
FLILITDGEARDGVRDPARALREKEVVIFSVGVYGANRTQLEEISGDGSLVFQVEKFDDL
KAIESKLIFRVSGARENCKRINLLDIVFVLDHSGSINSQQQESMMNLTIHLVEKANV
Download sequence
Identical sequences F6PJC0
9796.ENSECAP00000010498 ENSECAP00000010498 ENSECAP00000010498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]