SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000010502 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000010502
Domain Number 1 Region: 41-537
Classification Level Classification E-value
Superfamily Sema domain 1.83e-184
Family Sema domain 0.000000000015
Further Details:      
 
Domain Number 2 Region: 533-585
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000209
Family Plexin repeat 0.0023
Further Details:      
 
Domain Number 3 Region: 605-684
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000192
Family I set domains 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000010502   Gene: ENSECAG00000012115   Transcript: ENSECAT00000013249
Sequence length 777
Comment pep:known chromosome:EquCab2:4:29437363:29557455:-1 gene:ENSECAG00000012115 transcript:ENSECAT00000013249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNANKDDRPKSRSHDFYIFHALVVLSMTVLFLPVIETSKQNIPRVKLTYKDLLLSNSCIP
FLGSSEGLDFQTILLDEERGRLLLGAKDHIFLLSLVDLNKNFKKIYWPAAKERVELCKLA
GKDASTECANFIRVLQPYNKTHVYVCGTGAFHPICGYIDLGVYKEEVMFKLDTHILESGR
LKCPFDPQQPFASVMTDEYLYSGTASDFLGKDTAFTRSLGPTHDHHYIRTDISEHYWLNG
AKFIGTFPIPDTYNPDDDKIYFFFRESSQEGSTSDKTILSRVGRVCKNDVGGQRSLINKW
TTFLKARLICSIPGSDGADTHFDELQDIYLLPTRDERNPVVYGVFTTTSSIFKGSAVCVY
SMADIRAVFNGPYAHKESADHRWVQYDGRIPYPRPGTCPSKTYDPLIKSTRDFPDDVISF
IKRHPVMYKSVYPVAGGPTFKRINVDYRLTQIVVDHVVAEDGQYDVMFLGTDVGTVLKVV
SISKEKWNMEEVVLEELQVFKHSSIILNMELSLKQQQLYIGSRDGLVQLSLHRCDTYGKA
CADCCLARDPYCAWDGNACSRYAPTSKRRARRQDVKYGDPITQCWDIEDSISHETADEKV
IFGIEFNSTFLECIPKSQQASIKWYIQWSGDEHREELKPDERIIKTEYGLLIRSLQKKDS
GIYYCKAQEHTFIHTIVKLTLNVIENEQMQNTQRAQHDEGQVKDLLAESRLRYKDYIQIL
SSPNFSLDQYCEQMWHREKRRQRNKGGPKWKHMQEMKKKRNRRHHRNLDELPGAVAT
Download sequence
Identical sequences F6SG77
ENSECAP00000010502 ENSECAP00000010502 ENSECAP00000010527 9796.ENSECAP00000010527 XP_001491387.2.31192 XP_008531560.1.77740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]