SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000010649 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000010649
Domain Number 1 Region: 154-307
Classification Level Classification E-value
Superfamily E set domains 3.22e-25
Family Arrestin/Vps26-like 0.03
Further Details:      
 
Domain Number 2 Region: 6-152
Classification Level Classification E-value
Superfamily E set domains 1.19e-20
Family Arrestin/Vps26-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000010649   Gene: ENSECAG00000012938   Transcript: ENSECAT00000013414
Sequence length 328
Comment pep:known chromosome:EquCab2:7:3000864:3010272:-1 gene:ENSECAG00000012938 transcript:ENSECAT00000013414 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVVKSIELLLPKDAIYLAGSSVKGQVVLTLNSTLVNPIVKVELVGRGYVEWKEETGASR
DYSRDVICNNKADYVHKTKTFPVKDNWLSAGSHIFDFHFNLPPRLPSTFSSRTGHVSYFI
QASCMGREHVLAKRRMYLLVQGTSDGHQESPAQNPLLVEAERKVSYNCCSQGTISLQIQM
EKNSFVPGEKVAFTTEINNQTSKCIKTVVVALYGHVQYEGFTPKAERRLRVDSSELLRQE
ANTPIAPFATTKIVGAFNLPLLLSVSGGARDGGIMTTHYELVGTVHLPWSLSSVKVTVPI
IITSAPRDSSSCQLPEAGVVPESPERQN
Download sequence
Identical sequences F6QLL4
9796.ENSECAP00000010649 ENSECAP00000010649 XP_005611828.2.31192 ENSECAP00000010649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]