SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000010750 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000010750
Domain Number 1 Region: 896-1023,1219-1408
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.49e-52
Family p120GAP domain-like 0.024
Further Details:      
 
Domain Number 2 Region: 496-583
Classification Level Classification E-value
Superfamily E set domains 1.4e-16
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.043
Further Details:      
 
Domain Number 3 Region: 581-685
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000049
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.047
Further Details:      
 
Domain Number 4 Region: 399-495
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000056
Family Other IPT/TIG domains 0.0058
Further Details:      
 
Domain Number 5 Region: 54-106
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000000772
Family Plexin repeat 0.0012
Further Details:      
 
Domain Number 6 Region: 10-57
Classification Level Classification E-value
Superfamily Sema domain 0.00000000353
Family Sema domain 0.015
Further Details:      
 
Domain Number 7 Region: 682-771
Classification Level Classification E-value
Superfamily E set domains 0.000000364
Family E-set domains of sugar-utilizing enzymes 0.084
Further Details:      
 
Domain Number 8 Region: 353-385
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000942
Family Plexin repeat 0.0028
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000010750
Domain Number - Region: 198-230
Classification Level Classification E-value
Superfamily Plexin repeat 0.017
Family Plexin repeat 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000010750   Gene: ENSECAG00000011570   Transcript: ENSECAT00000013534
Sequence length 1438
Comment pep:known chromosome:EquCab2:4:86335276:86488667:-1 gene:ENSECAG00000011570 transcript:ENSECAT00000013534 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QIRVDGPRGNALQYETVQVVDPGPVLRDMAFSKDHEQLYIMSERQLTRVPVESCGQYQSC
SECLGSGDPHCGWCVLHNTCTRKERCERSREPRRFASEMKQCVRLTVHPSNISVSQYNVL
LVLETYNVPELTAGVNCTFEDLSEMDGLVIGNQIQCYSPAAKEVPRIITENGDHHVVQLQ
LKSKETGMTFASTSFVFYNCSVHNSCLSCVESPYRCHWCKYRHVCTHDPKTCSFQEGRVK
LPEDCPQLLRVDKILVPVEVIKPITLKAKNLPQPQSGQRGYECILNIQGSEQRVPALRFN
SSSVQCQNTSYSYEGMEINNLPVELTVVWNGHFNIDNPAQNKVHLYKCGAMRESCGLCLK
ADPDFECGWCQGQAQCTLRQHCPIHESQWLELSGANSKCTNPRITEIIPVTGPREGGTKV
TIRGENLGLEFRDIASHVKVAGVDCSPLVDGYIPAEQIVCEMGEAKPSQHAGFVEICVAV
CRPEFMARSSQLYYFMTLTLSDLKPSRGPMSGGTQVTITGTNLNAGSNVVVMFGKQPCVF
HRRSPSYIVCNTTSSDEVLEMKVTVQVDRAKIHQDLVFQYVEDPTIVRIEPEWSIVSGNT
PIAVWGTHLDLIQNPQIRAKHGGKEHINLCEVLNSTEMTCQAPALALGPDHQSDLTERPE
EFGFILDNVQSLLILNKTNFTYYPNPVFEAFGPSGILELKPGTPIILKGKNLIPPVAGGN
VKLNYTVLVGEKPCTVTVSDAQLLCESPNLIGRHKVMARVGGMEYSPGMVYIAPDSPLSL
PAIVSIAVAGGLLIIFIVAVLIAYKRKSRESDLTLKRLQMQMDNLESRVALECKEAFAEL
QTDIHELTSDLDGAGIPFLDYRTYTMRVLFPGIEDHPVLRDLEVPGYRQERVEKGLKLFA
QLINNKVFLLSFIRTLESQRSFSMRDRGNVASLIMTVLQSKLEYATDVLKQLLADLIDKN
LESKNHPKLLLRRTESVAEKMLTNWFTFLLYKFLKECAGEPLFSLFCAIKQQMEKGPIDA
ITGEARYSLSEDKLIRQQIDYKTLVLSCVNPDSANSPEVPVKILNCDTITQVKEKILDAI
FKNVPCSHRPKAADMDLEWRQGSGVRMILQDEDITTKIENDWKRLNTLAHYQVPDGSVVA
LVSKQVTAYNAVNNSTVSRTSASKYENMIRYTGSPDSLRSRTPMITPDLESGVKMWHLVK
NHEHGDQKEGDRGSKMVSEIYLTRLLATKGTLQKFVDDLFETIFSTAHRGSALPLAIKYM
FDFLDEQADKHGIHDPHVRHTWKSNCLPLRFWVNMIKNPQFVFDIHKNSITDACLSVVAQ
TFMDSCSTSEHRLGKDSPSNKLLYAKDIPSYKNWVERYYSDIGKMPAISDQDMNAYLAEQ
SRMHMNEFNTMSALSEIFSYVGKYSEEILGPLDHDDQCGKQKLAYKLEQVITLMSLDS
Download sequence
Identical sequences F6SNF6
9796.ENSECAP00000010750 ENSECAP00000010750 ENSECAP00000010750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]