SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000010793 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000010793
Domain Number 1 Region: 101-206
Classification Level Classification E-value
Superfamily Second domain of FERM 3.66e-37
Family Second domain of FERM 0.0000425
Further Details:      
 
Domain Number 2 Region: 204-350
Classification Level Classification E-value
Superfamily PH domain-like 6.76e-36
Family Third domain of FERM 0.00071
Further Details:      
 
Domain Number 3 Region: 9-100
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.94e-19
Family First domain of FERM 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000010793   Gene: ENSECAG00000012628   Transcript: ENSECAT00000013583
Sequence length 686
Comment pep:known chromosome:EquCab2:14:59488641:59736014:1 gene:ENSECAG00000012628 transcript:ENSECAT00000013583 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCFCAVPEEFYCEVLLLDESKLTLTSQQQGIKKSTKGSVVLDHVFRHINLVEIDYFGLR
YCDRSHQTYWLDPAKTLAEHKELINTGPPYTLYFGIKFYAEDPCNLKEEITRYQFFLQVK
QDVLQGRLPCPVNVAAQLGAYAIQSELGDYDPYKHTAGYVSEYRFVPDQKEELEEAIERI
HKTLMGQAPSEAELNYLRTAKSLEMYGVDLHPVYGENKSEYFLGLTPVGVVVYKNKKQVG
KYFWPRITKVHFKETQFELRVLGKDCNETSFFFEARSKTACKHLWKCSVEHHTFFRMPEN
ESNSLSRRLSKFGSMSYKHRYSGRTALQMSRDLSIQLPRPDQNVARSRSKTYPKRIAQTQ
PAGSNSINRVTVNVENGENEGTTKIIAPSPIKSFKKAKNENSPDTQRSKSHAPWEENGPQ
SGLYNSPNDRTKSPKFPYTRRRNPSCGSDNDSVQPTRRRKAHNSGEDSDLKQRRRSRSRC
NTSSGSESENSNREHRKKRNRIRQENDMVDSAPQWEAVLRRQKEKNQADSNNRRSRHRSR
SRSPDIQAKEELWKHIQKELVDPSGLSEEQLKEIPYTKIETQGDPIRIRHSHSPRSYRQY
RRSQCSDGERSVLSEVNSKTDLVPPLPVTRSSDAQGSGGSTVHQRRNGSKDSLIEEKSQT
STSSLAGKHTAKTIKTIQASRLKIET
Download sequence
Identical sequences F6SEU0
ENSECAP00000010793 ENSECAP00000010793 XP_014586218.1.31192 9796.ENSECAP00000010793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]