SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000010810 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000010810
Domain Number 1 Region: 28-520
Classification Level Classification E-value
Superfamily Sema domain 4.05e-193
Family Sema domain 0.00000000000000384
Further Details:      
 
Domain Number 2 Region: 516-567
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000715
Family Plexin repeat 0.0026
Further Details:      
 
Domain Number 3 Region: 587-669
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000132
Family V set domains (antibody variable domain-like) 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000010810   Gene: ENSECAG00000012662   Transcript: ENSECAT00000013605
Sequence length 766
Comment pep:known chromosome:EquCab2:4:28572471:28783608:-1 gene:ENSECAG00000012662 transcript:ENSECAT00000013605 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCFARIVCLFWGVLLTARANYPNGKNNVPRLKLSYKEMLDSNNVITFNGLANSSSYHTF
LLDEERSRLYVGAKDHIFSFNLVNIKDFQKIVWPVSYTRRDECKWAGKDILKECANFIKV
LKAYNQTHLYACGTGAFHPICTYIEIGHHPEDNIFKLEDSHFENGRGKSPYDPKLLTASL
LIDGELYSGTAADFMGRDFAIFRTLGQHHPIRTEQHDSRWLNDPRFISAHLIPESDNPED
DKVYFFFRENAIDGEHTGKATHARIGQICKNDFGGHRSLVNKWTTFLKSRLICSVPGPNG
IDTHFDELQDVFLMNSKDPKNPVVYGVFTTSSNIFKGSAVCMYSMSDVRRVFLGPYAHRD
GPNYQWVPYQGRVPYPRPGTCPSKTFGGFDSTKDLPDDVITFARSHPAMYNPVFPINNRP
IMIKTDVNYQFTQIVVDRVDAEDGQYDVMFIGTDVGTVLKVVSIPKETWHDLEEVLLEEM
TVFREPTTISAMELSTKQQQLYIGSTAGVAQLPLHRCDVYGKACAECCLARDPYCAWDGS
SCSRYFPTAKRRTRRQDIRNGDPLTHCSDLQHHGKIDAEKNLEERIIYGVENSSTFLECS
PKSQRALVYWQFQRRNEEQKEEIRVDDHIIRTEQGLLLRSLQRKDSGNYLCHAVEHGFMQ
TLLKVTLEVIDTEHLEELLHKDDDEISNSMTPSQKVWYRDFMQLINHPNLNTMDEFCEQV
WKRDRKQRRQRPGHTQGNSNKWKHLQENKKGRNRRTHEFERAPRSV
Download sequence
Identical sequences F6RIR4
ENSECAP00000010810 9796.ENSECAP00000010810 ENSECAP00000010810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]