SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000010822 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000010822
Domain Number 1 Region: 963-1271
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 7.22e-88
Family Complement components 0.0000323
Further Details:      
 
Domain Number 2 Region: 1342-1475
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 1.7e-42
Family Alpha-macroglobulin receptor domain 0.000000438
Further Details:      
 
Domain Number 3 Region: 790-910
Classification Level Classification E-value
Superfamily E set domains 1.54e-29
Family SVA-like 0.027
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000010822
Domain Number - Region: 368-427
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.0033
Family Invasin/intimin cell-adhesion fragments 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000010822   Gene: ENSECAG00000012558   Transcript: ENSECAT00000013620
Sequence length 1477
Comment pep:known chromosome:EquCab2:6:36171428:36206999:-1 gene:ENSECAG00000012558 transcript:ENSECAT00000013620 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKSKYLHPSFILLLLVFMPTNASVSGKPHYMVLVPSLLHSEILEKGCLLLSHLNETVTV
SASLESLRENRSLFTDLVAEKDLFHCVSFIVPRASSNEEVMFLTIQVKGATQEFKKRTTV
LIKKKESLVFVQTDKPIYKPGQTVKFRVVVLDENFYPLNELIPLVYIKDPKENRIAQWQN
LKLESGLKQLTFPLSSEPFQGSYKVVVQKESGGRAEHPFIVEEFVLPKFEVQVTVPKIIT
ILEQEVNVSVCGLYTYGKPVPGHATVTVCRKYSNPSNCFGRESEAICEKFSQQLNNQGCL
SQQVKTKIFQMKREGFAMKLEVEAKIQEEGTEVELTGRGSSEITRTITKLSFVKVDSNFR
QGIPFFGQVLLVDGKGVPMPNKLIFITANEANYSSNTTTDEHGLVQFSINTTNIMDTTLT
VTVKHKDHSPCHAFQWLSEENEEAHHTANLVFSPSKSFVHLEPMPRELPCGQTQTVQVHY
ILNGQVLQELKELVFYYLMMAKGGIVRNGTHTLPVEQGDMRGHFSVSVLVESDIAPIARL
LVYTILPDGEVVGDSAKYEIENCLANKVDLSFSPAQSLPGSPAHLRVTASPQSLCALRAV
DQSVLLMKPEAELSPASVYSLLPVKDLTGFPESLNQNEEDDGDCVNHRNVYINGIMYSPV
SNTNEKDIYSFLKDMGLRVFTNSKIHKPKVCTQHEYFTTRKGWPCGRVVKFARSEAGSHE
FFREIHVSEPPTETVRKYFPETWIWDLVVVNSSGVGEVGVRVPDTITEWKAGALCLSSGA
GLGLSPTASLRAFQPFFVELTIPYSVIRGEAFTLKATVFNYLPKRIRVSVNLEESPAFLA
VPGEKEQGSHCISGNGRQTVSWAVTPKSLGNVNFTVSAEALESQELCGTEVAVVPEYGKK
DTIIKPLLVEPEGLEKEATFNSLLCPSDAEVSDQLSLKLPPNVVEESARASFSVLGDILG
SAMRDTQNLLKMPYGCGEQNMVLFAPNIYVLDYLNETQQLTPEARSKAIGYLNTGYQTQL
NYKHHDGSYSTFGERRGRSEGNTWLTAFVLKTFAKARTYIFIDEAHITEALTWLSHKQKD
NGCFRSSGSLLNNAIKGGVQDEVTLSAYITISLLEIPLAATHPVVRNALFCLESAWKSAK
EGPHGSHVYTKALLAYAFALAGNQDKRREVLESLTEEAVKEDNSVHWTRPQKPKAPVEHF
HQPRAPSAEVEMTSYVLLAYLTAHHTPTSEDLTSATLIVKWITKQQNSQGGFSSTQDTVV
ALHALSKYGAATFTRTGMSAEVTIESSKFSKKFQVDNKNRLLLQQISLPKVPEEYSMRVT
GKGCVYLQTSFKYNILPEKEKFPFALEVQTLPQTCEGSKAHTSFQITLNVSYTGSRPASN
MAIADVKMVSGFVPLKPTVKTLESSNHVTRTEVSNNHVLIYLDEVTNQTLSLSFTVVQDI
PVRDLKPAIVKVYDYYETDEFAIAEYNAPCGKDLGNA
Download sequence
Identical sequences F6RI47
ENSECAP00000010822 9796.ENSECAP00000010822 ENSECAP00000010822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]