SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000010937 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000010937
Domain Number 1 Region: 199-340
Classification Level Classification E-value
Superfamily PH domain-like 1.2e-44
Family Third domain of FERM 0.00000011
Further Details:      
 
Domain Number 2 Region: 89-198
Classification Level Classification E-value
Superfamily Second domain of FERM 2.75e-38
Family Second domain of FERM 0.000000594
Further Details:      
 
Domain Number 3 Region: 490-577
Classification Level Classification E-value
Superfamily Moesin tail domain 4.71e-33
Family Moesin tail domain 0.0000039
Further Details:      
 
Domain Number 4 Region: 2-87
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.61e-26
Family First domain of FERM 0.0000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000010937   Gene: ENSECAG00000012900   Transcript: ENSECAT00000013753
Sequence length 577
Comment pep:known chromosome:EquCab2:X:48138007:48198254:1 gene:ENSECAG00000012900 transcript:ENSECAT00000013753 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKTINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTKGFSTWLK
LNKKVTAQDVRKESPLLFKFRAKFYPEDVSEELIQDITQRLFFLQVKEGILNDDIYCPPE
TAVLLASYAVQSKYGDFNKEVHKSGYLAGDKLLPQRVLEQHKLNKDQWEERIQVWHEEHR
GMLREDAVLEYLKIAQDLEMYGVNYFSIKNKKGSELWLGVDALGLNIYEQNDRLTPKIGF
PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTI
EVQQMKAQAREEKHQKQMERALLENEKKKREMAEKEKEKIEREKEELMERLKQIEEQTKK
AQQELEEQTRRALELEQERKRAQSEAEKLAKERQEAEEAKEALLQASQDQKKTQEQLALE
MAELTARISQLEVARQKKESEAVEWQQKAQMVQEDLEKTRAELKTAMSTPHVAEPAENDQ
DEQDENGAEASADLRADAMAKDRSEEERTTEAEKNERVQKHLKALTSELANARDESKKTA
NDMIHAENMRLGRDKYKTLRQIRQGNTKQRIDEFESM
Download sequence
Identical sequences F6PUX2
ENSECAP00000010937 ENSECAP00000010937 9796.ENSECAP00000010937 XP_001504911.1.31192 XP_008541350.1.77740 XP_014705687.1.49734 XP_014705695.1.49734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]