SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000011034 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000011034
Domain Number 1 Region: 2-59
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.35e-19
Family N-terminal domain of xrcc1 0.00099
Further Details:      
 
Domain Number 2 Region: 306-459
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000475
Family Ankyrin repeat 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000011034   Gene: ENSECAG00000013026   Transcript: ENSECAT00000013863
Sequence length 1170
Comment pep:known chromosome:EquCab2:7:71629475:71659409:1 gene:ENSECAG00000013026 transcript:ENSECAT00000013863 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLMSLADSKQGKNRSGVRMFKDDDFLAPASSESWDRLRLTCSQPFTRHQSFGLAFLRVCS
SLDSLDEPVVDPSDPGSSGPSQGSSDAEESGPSPWLANPSIRRIFFPDPHTSTKEMSELR
NILKQLQPGTLGRSACMVLSAAHRAPPASVASAKNNQAEPGASHPDSAEPRPEEPTSENH
VGRTKRRKVQARRPLSNSNSRPNRRGIAKAGQRKQHQAEAQSSSAQESGQCPICAGCFSM
EILLQHAATCGEASPPHPASPSSSPSSSPSALRLHCVTLTPVPLKPSPLPNWTEIVNKKL
KFPPQLLAAIQEGRLGLVQQLLESGVEATGGGPGGPLRNVEEAEDRSWREALNLTIRLGH
EAITDVLLANVKFDFRQIHEALLVAVDTNQPAVVRRLLARLEREKGRKVDTRSFSLAFFD
SSIDGSRFAPGITPLTLACQKDLYEIAQLLMDQGHTIARPHPVSCACLECSNARRYDLLK
FSLSRINTYRGIASRAHLSLASEDAMMAAFQLSRELRHLARKEPEFKPEYIALELLSQDY
GFELLGMCRNQSEVTVVLNDLGKDSEMEPEAECLGQAFEEGIPNLARLRLAVNYNQKRFV
AHPICQQVLSSVWCGNLAGWRGSTTIWKLFVAFLIFLTMPFLCLGYWLAPKSRLGRLLKI
PVLKFLLHSASYLWFLIFLLGESLVMETQLSTFRGRSQSVWETSLHMIWVAGFLWFECKE
VWIEGLCSYLLDWWNFLDMVILSLYLAAFALRLLLAGLAHTHCQDAPGGAACHYFTMAER
SEWRTEDPQFLAEVLFAVTSMLSFTRLAYILPAHESLGTLQISIGKMIDDMIRFIFILMI
ILTAFLCGLNNIYVPYQETERLGNFNETFQFLFWTMFGMEEHSVVDMPQFLVPEFVGRAL
YGIFTIVMVIVLLNMLIAMITNSFQKIEDDADVEWKFARSKLYLSYFREGLTLPVPFNIL
PSPKAIFYLLRRTFQFICCYCSDCKTKKQDYPPIPTFANPGAGAGPGEGERGSYRLRVIK
ALVQRYIETARREFEETRRKDLGNRLTELTKTVSRLQSEVAGVRRTLAEGGTPRPPAGAS
ILSRYITRVRNSFQNLGPPIPETPELTVPGTMEAHGSSETELQDAEGARTPASGESGPSS
PTHVLVHREQESEGAGDLPQEEYLGTKGEA
Download sequence
Identical sequences F6ZVC4
ENSECAP00000011034 ENSECAP00000011034 9796.ENSECAP00000011034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]