SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000011049 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000011049
Domain Number 1 Region: 3-96
Classification Level Classification E-value
Superfamily Immunoglobulin 1.4e-20
Family I set domains 0.0069
Further Details:      
 
Domain Number 2 Region: 108-150
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000214
Family EGF-type module 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000011049   Gene: ENSECAG00000013341   Transcript: ENSECAT00000013882
Sequence length 371
Comment pep:known chromosome:EquCab2:14:36906806:36942038:1 gene:ENSECAG00000013341 transcript:ENSECAT00000013882 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XTRPKLKKMKSQTGQVGEKQSLKCEAAAGNPQPSYRWFKDGKELNRSRDIRIKYGNGRKN
SRLQFNKVKVEDAGEYVCEAENILGKDTVRGRLHVNSVSTTLSSWSGHARKCNETAKSYC
VNGGVCYYIEGINQLSCKCPNGFFGQRCLEKLPLRLYMPDPKQTHRGSKLKEAEELYQKR
VLTITGICVALLVVGIVCVVAYCKTKKQRKQMHNHLRQNMCPAHQNRSLANGPSHPRLDP
EEIQMADYISKNVPATDHVIRRETETTFSGSHSCSPSHHCSTATPTSSHRHESHTWSLER
SESLTSDSQSGIMLSSVGTSKCNSPACVEARARRAAAYTLEERRRAAVPPYHDSIDSLRD
SPHSERSVSTL
Download sequence
Identical sequences F6ZQ40
ENSECAP00000011049 ENSECAP00000011049 9796.ENSECAP00000011049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]