SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000011119 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSECAP00000011119
Domain Number - Region: 74-107
Classification Level Classification E-value
Superfamily SAP domain 0.00366
Family SAP domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000011119   Gene: ENSECAG00000013432   Transcript: ENSECAT00000013962
Sequence length 280
Comment pep:known chromosome:EquCab2:19:47729094:47736371:1 gene:ENSECAG00000013432 transcript:ENSECAT00000013962 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DEENVILTLVPVNEEHNEEHQMESSVSSTSEVNLKTPRTDDKVHLPQTNEQFKTRPKPRC
KAPILPLPAILPPINKVRRDTLRNWCQQFHLSTDGDKIEVYLRLQEHAYSEQKQNVPETP
QEAKLQSCSGKCKMVTKRARVPKRCKKPEREEGTNIVEVITSAQEAMLAAWARIAARAVQ
PKAMNSCPIPTSVETFLPQASGVRWCVVHGRPLWADTKGWVRLHFHAGQTWVPDTPRRMI
SLFLLPACTFPSPDLEDNMLCPECAQRNKKMMRRFNTMKK
Download sequence
Identical sequences F7BJH5
9796.ENSECAP00000011119 ENSECAP00000011119 ENSECAP00000011119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]