SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000011160 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000011160
Domain Number 1 Region: 389-518
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000127
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 2 Region: 325-363
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000108
Family EGF-type module 0.005
Further Details:      
 
Domain Number 3 Region: 284-328
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000127
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000011160
Domain Number - Region: 365-400
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0268
Family EGF-type module 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000011160   Gene: ENSECAG00000013434   Transcript: ENSECAT00000014007
Sequence length 685
Comment pep:known chromosome:EquCab2:1:147680547:147688146:-1 gene:ENSECAG00000013434 transcript:ENSECAT00000014007 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAASRSASGWALLLLVALWQQRAAGSGVFQLQLQEFANERGVLASGRPCEPGCRTFFRV
CLKHFQAVVSPGPCTFGSVSTPVLGTNSFAVGDDSSGGGRNPLQLPFNFTWPGTFSLIIE
AWHAPGDDLRPEALTPDALISKIAIQGSLAVGQNWLLDEQTSLLTRLRYSYRVICSDNYY
GDSCSRLCKKRNDHFGHYVCQPDGSLSCLPGWTGEYCEQPVCLSGCHEQNGYCSKPAECI
CRPGWQGRLCNECIPHNGCRHGTCNTPWQCTCDEGWGGLFCDQDLNYCTHHSPCKNGATC
SNSGQRSYTCTCRPGYTGVDCELELSECDSNPCRNGGSCKDQEDGYHCLCPPGYYGLHCE
HSTLSCADSPCFNGGSCQERNQGASYACECPPNFTGSNCEKKVDRCTSNPCANGGQCLSR
GPTRMCRCRPGFTGTHCERHISDCARSPCAHGGTCHDLENGLVCTCPPGFSGRRCEVRTP
SDICASGPCFNGATCYTGLSTDSFVCNCPYGFVGSRCEFPVSMPPSFPWVAVSLGVGLVV
VLVLLGMVAVAVRQLRLRRPDDDSREAMNNLSDFQKDNLIPTAQLKNTNQKKELEVDCGL
DKSNCGKQQNHTLDYNLAPGPLGRGTILGKYSHGDKSLGEKAPLRLHSEKPECRISAICS
PRDSMYQSVCLISEERNECVIATEV
Download sequence
Identical sequences F7BDL8
ENSECAP00000011160 9796.ENSECAP00000011160 ENSECAP00000011160 XP_001503540.1.31192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]