SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000011290 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000011290
Domain Number 1 Region: 3815-4015
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.9e-38
Family Laminin G-like module 0.004
Further Details:      
 
Domain Number 2 Region: 3326-3441
Classification Level Classification E-value
Superfamily Cadherin-like 1.96e-32
Family Cadherin 0.0011
Further Details:      
 
Domain Number 3 Region: 1127-1256
Classification Level Classification E-value
Superfamily Cadherin-like 9.68e-32
Family Cadherin 0.0014
Further Details:      
 
Domain Number 4 Region: 3226-3330
Classification Level Classification E-value
Superfamily Cadherin-like 7.14e-31
Family Cadherin 0.0018
Further Details:      
 
Domain Number 5 Region: 3122-3225
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-29
Family Cadherin 0.00048
Further Details:      
 
Domain Number 6 Region: 2279-2385
Classification Level Classification E-value
Superfamily Cadherin-like 8.9e-28
Family Cadherin 0.00095
Further Details:      
 
Domain Number 7 Region: 1020-1138
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-27
Family Cadherin 0.00056
Further Details:      
 
Domain Number 8 Region: 921-1024
Classification Level Classification E-value
Superfamily Cadherin-like 4e-27
Family Cadherin 0.0014
Further Details:      
 
Domain Number 9 Region: 2806-2914
Classification Level Classification E-value
Superfamily Cadherin-like 7.42e-27
Family Cadherin 0.0015
Further Details:      
 
Domain Number 10 Region: 3020-3128
Classification Level Classification E-value
Superfamily Cadherin-like 9.95e-27
Family Cadherin 0.00068
Further Details:      
 
Domain Number 11 Region: 816-919
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-25
Family Cadherin 0.00081
Further Details:      
 
Domain Number 12 Region: 1557-1661
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-25
Family Cadherin 0.0012
Further Details:      
 
Domain Number 13 Region: 1762-1882
Classification Level Classification E-value
Superfamily Cadherin-like 3.01e-25
Family Cadherin 0.0019
Further Details:      
 
Domain Number 14 Region: 137-259
Classification Level Classification E-value
Superfamily Cadherin-like 8.42e-24
Family Cadherin 0.0015
Further Details:      
 
Domain Number 15 Region: 2072-2179
Classification Level Classification E-value
Superfamily Cadherin-like 7.71e-23
Family Cadherin 0.0026
Further Details:      
 
Domain Number 16 Region: 2915-3026
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-22
Family Cadherin 0.0016
Further Details:      
 
Domain Number 17 Region: 710-822
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-22
Family Cadherin 0.0013
Further Details:      
 
Domain Number 18 Region: 3436-3540
Classification Level Classification E-value
Superfamily Cadherin-like 1.18e-21
Family Cadherin 0.0015
Further Details:      
 
Domain Number 19 Region: 2179-2286
Classification Level Classification E-value
Superfamily Cadherin-like 1.83e-21
Family Cadherin 0.0015
Further Details:      
 
Domain Number 20 Region: 1450-1554
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-21
Family Cadherin 0.0011
Further Details:      
 
Domain Number 21 Region: 457-558
Classification Level Classification E-value
Superfamily Cadherin-like 3e-21
Family Cadherin 0.00084
Further Details:      
 
Domain Number 22 Region: 1663-1784
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-20
Family Cadherin 0.002
Further Details:      
 
Domain Number 23 Region: 2587-2697
Classification Level Classification E-value
Superfamily Cadherin-like 3.28e-20
Family Cadherin 0.0012
Further Details:      
 
Domain Number 24 Region: 2386-2486
Classification Level Classification E-value
Superfamily Cadherin-like 3e-19
Family Cadherin 0.0017
Further Details:      
 
Domain Number 25 Region: 2489-2599
Classification Level Classification E-value
Superfamily Cadherin-like 3.43e-19
Family Cadherin 0.002
Further Details:      
 
Domain Number 26 Region: 1358-1456
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-17
Family Cadherin 0.0066
Further Details:      
 
Domain Number 27 Region: 1233-1347
Classification Level Classification E-value
Superfamily Cadherin-like 6.42e-17
Family Cadherin 0.0038
Further Details:      
 
Domain Number 28 Region: 1875-1973
Classification Level Classification E-value
Superfamily Cadherin-like 3.01e-16
Family Cadherin 0.0027
Further Details:      
 
Domain Number 29 Region: 562-663
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000694
Family Cadherin 0.0062
Further Details:      
 
Domain Number 30 Region: 1981-2084
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000557
Family Cadherin 0.0019
Further Details:      
 
Domain Number 31 Region: 2706-2804
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000728
Family Cadherin 0.0039
Further Details:      
 
Domain Number 32 Region: 366-453
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000143
Family Cadherin 0.0033
Further Details:      
 
Domain Number 33 Region: 3545-3634
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000214
Family Cadherin 0.0074
Further Details:      
 
Domain Number 34 Region: 4130-4169
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000224
Family EGF-type module 0.0056
Further Details:      
 
Domain Number 35 Region: 4042-4171
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000173
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 36 Region: 33-149
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000228
Family Cadherin 0.0079
Further Details:      
 
Domain Number 37 Region: 4017-4054
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000193
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000011290
Domain Number - Region: 245-354
Classification Level Classification E-value
Superfamily Cadherin-like 0.000104
Family Cadherin 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000011290   Gene: ENSECAG00000013011   Transcript: ENSECAT00000014155
Sequence length 4591
Comment pep:known chromosome:EquCab2:27:23697841:23812118:1 gene:ENSECAG00000013011 transcript:ENSECAT00000014155 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRHLPFLLLLLLLLQHFGDSDASQTLEQTPLQFTHFQYNVTVHENSAAKTYVGHPVKMG
IYITNPVWELRYKIVSGDNENLFKAEEYILGDFCFLRIRTKGGNTAILNREVKDHYTLIV
KAVEKNTNAEARTVVRVQVLDTNDLRPLFSPTSYSVSLPENTAIRTSIARVSATDADIGT
NGEFYYSFKDRTDMFAIHPTSGAVVLTGRLDYAETMLYEMEILAVDRGMKLYGSSGISSM
AKLTVHVEQANECAPVITAVTLSPSELDKDPTYAIVTVDDCDQGANGDIASLSIVAGDLL
QQFRTVRSSPGSKEYKIKAVGGIDWDSHPFGYNLTLQAKDKGTPPQFSSVKVIHVTSPQF
KAGPVRFEKDVYRAEISEFAPSNTPVVMVKATPCYSHLRYVFKSTPGKAKFSLNHNTGLI
SILEPIKRQQAAHFELEVTTSDRKASTRVLVKVVSANTNPPEFTETAYKASFDENVPVGT
TVMSVSAVDPDEGENGYVTYSIANLNHVPFVINHFTGAVSTSENLDYELMPRVYTLRIRA
SDWGLPYRREVEVLATLTLNNLNDNTPLFEKINCEGTIPRDLGVGEQITTVSAIDADELQ
LVRYQIEAGNELDLFSLHPNSGVLSLKQPLMDGLGAKVSFHSLRITATDGENFATPLYIN
ITVAASRKPVNLQCEETGVAKMLAEKLLQANKLHSQGEVEDIFFDSHSVNAHAPQFRNTL
PTGIEVKENHPVGSNIISMNATDLDTGFNGKLVYAISGGNEDSCFIIDMETGMLKILSPL
DRETTDKYTLNISVSDLGIPQKAAWHLLDIRVLDANDNPPEFLQERYFVEVSEDKEINSE
IIQVEATDKDLGPNGRVTYSILTDTDKFSIDSMTGVVKIVDPLDRELQHVHYLKIEARDQ
ASEEPQLLSTVLLKVSLEDVNDNPPKFIPPNYRVKVREDLPEGTIIMWLEAYDPDLGQSS
QVRYSLLDHGEGNFDVDKLSGAVRIVQQLDFEKKQVYNLTVRAKDKGKPISLSSTCYVEV
EVIDVNENLHPPVFSSFVEKGVVKEDVPIGSSVMAVSAHDEDTGRDGEIRYSIRDGSGVG
VFKIDEETGVIETSDRLDRESTSHYWLTVYATDQGVVPLSSFIEVYIEVEDVNDNAPQTS
EPVYYPEVMENSPKDVSVVQIQAFDPDSSSNDKLTYKITSGNPQGFFAIHPKTGLITTTS
RKLDREQQDEHILEVTVTDNGSPPKSTIARVIVKILDENDNKPQFLQKFYKIRLPEREKP
ERERNARREPLYRVIATDKDEGPNAEISYSIEDGNEHGKFFIEPKTGVVSSKKFSGAGEY
DILSIKAVDNGRPQKSSTTRLHIEWISKPTPSLEPISFEESFFTFTVMESDPVAHMIGVL
SVEPPGIPLWFDIIGGNYESHFDVDKGTGTIIVAKPLDAEQKSNYNLTVEATDGTTTILT
QVFIKVIDTNDHRPQFSTSKYEVVIPEDTVPETEILQISALDKDEKNKLIYTLQSSIDPL
SLKKFRLDPATGLLYTSEKLDHEAIHQHVLTVMVRDQDVPVKRNFARIVVNVSDTNDHAP
WFTSSSYEGRVYESAAVGSVVLQVTALDKDKGKNAEVLYSIESVSLGNIGHSFTIDPILG
SIKTAKELDRSNQVEYDLMVKATDKGSPPMSEITSVHIFVTIADNASPKFTSKEYSVEIS
ETISVGSFVGMVTAHSQSSVIYEIKDGNIADAFDINPHSGSIITQKALDFETLPIYTLII
QGTNMAGLSTNTTVLVHLQDENDNSPVFMQAEYTGLISESASINSVVLTAENVPLVIRAV
DGDKESNALLVYHIVEPSIHKYFAIDSSTGAIHTVLSLDYEETSTFHFTVQVHDMGTPRL
FAEYAANVTIHVIDINDCPPVFSKSLYEASLLLPTYKGVKVITVNATDADSSAFSQLMYS
ITEGNIGEKFSVDYRTGTITVQNTTQLRSRYELTMRASDGRFASFTSVKINVKESKESQL
KFTQDFYSAVVKENSTEARTLAVITAIGNPINEPLFYQILNPDRRFKISRTSGVVSTTGV
PFDREQQEAFDVVVEVTQERKPSAVAHVVVKVIIEDQNDNAPVFVNLPYYAVVKVDTVVG
HVIRYVTAVDRDSGRNGEVHYYLKEHHEHFQIGSSGEISLKKQFEPDTLNKEYLVTVVAK
DGGNPAFSAEVIVPITVMNKAMPVFEKPFYSAEIPENIQIHSPVVHIQANSPEGLKVFYS
ITDGDPFSQFTINFNTGVINVIAPLDFESHPAYKLSIRATDSLTGAHAEVFVDIIVEDIN
DNPPVFVQQSYAATLSEASVIGTSVVQVKATDSDSEPNRGISYHMFGNHSKSHDHFHIDS
STGLISLVRTLDYEQFQQHKIFVRAVDSGMPPLSSDVIVTVDVTDLNDNPPLFDQQIYEA
KISEHATHGHFVTCVKAYDADSSDIDKLEYSILSGNDHKNFVIDSETGIITLSNLRRHTL
KPFYSLNTSVSDGVFRSSAQVHVTVIGGNLHSPVFLQNEYEVELAENAPVHTLVIEVKAT
DGDSGIYGDITYHIVNDFAKDRFYTNERGQIFTLEKLDRETPAEKVISVRLMAKDAGGKV
AFCTINVILTDDNDNAPQFRATKYEVNIGSSAPKGTSVIKVLASDADEGSNADVTYAIEA
DSESVKENLEINKLSGIITTKESLIGLENEFFTFFVRAVDNGSPPKESVVPVYVKILPPE
MQLPKFTEPFYTYTVPEDMPIGTEIDLIRAEHRGTVLYSLIKGNTPESNRDEFFVIDRQS
GRLKLEKSLDHETTKWYQFSILARCTHDDSEVVASVDVSIQVKDANDNSPVVESNPYEAF
IVENLPGGSRVIQIRASDLDSGTNGQVMYSLDQSQSVEVLESFAINMETGWITTLKELDH
EKRDNYQIKVVASDHGEKVQLSSTAIVDVTVTDVNDSPPRFTAEIYKGTVSEDDPPGGVI
AILSTTDADSEEINRQVTYYITGGDPLGQFAIENIQSEWKVYVKKPLDREKRDNYLLTIT
ATDGTFSSKAIVEVKVLDANDNSPICEKTLYSDTIPEDAFPGKLILQVSATDADIRSNAE
ITYTLFGPGAEKFKLNPDTGELKTLVPLDREEQAVYNLLVKATDGGGRFCQAHIVLTLED
VNDNAPEFSADPYTITVFENTEPGTLLTRVQATDADAGLNRKISYSLINSADGQFSINEL
SGIIQLEKPLDREVQAVYTLTLKAVDHGLPRRLTGVGTVVVSVLDINDNPPVFEYREYGA
TVSEDILIGTEVLQVYAASRDIEANAEITYSIISGNEHGKFSIDSKTGAIFIIENLDYES
SHEYYLTVEATDGGTPSLSDVATVNVNVTDINDNTPVFSQDTYTAVISEDAVLEQSVITV
MADDADGPSNSHIHYSIIDGNQGGPFTIDPARGEVKVTKLLDRETISGYTLTVQASDNGS
PPRVNTTTVNIDVSDVNDNAPVFSKRIYSIIIQENKPVGFSVLQLVVTDKDSSHNGPPFF
FTIVSGNEDGAFDVNQQGVLLTSTAIRRNVKDHYLLHVKVADNGKPQLSSLTYIDIRVIE
ESIYPPAILPLEIFITAFGEEYSGGVIGKIHATDQDVYDTLTYSLDPQMDNLFSVSSTGG
KLIAHKKLDIGQYLLNVSVTDGKFTTTADITVHIRQVTQEMLNHTVALRFANLTPEEFVG
DYWRNFQRALRNILGVRKNDIQIISLQPSEPHPHLDVLLFVEKSGSAQGSTKQLLHKINS
SVTDIEEIIGVRILDVFQKLCAGLDCPWKFCDEKLSVDENVMSTHSTARLSFVTPRHRRT
AVCLCKEGRCPFVHHECEDTPCPEGSECVTDPREEKYTCVCPGGKFGQCPGSSSVTFTGN
SFVKYRLMENENKLEMKLTMRLRTYSAHAVVMYARGTDYSILEIHNGRLQYKFDCGSGPG
IVSVQSIQVNDGLWHAVSLEVNGNYARLVLDQVHTASGTAPGTLKTLNLDNHVFFGGHVR
QQGTRHGRSPQVGNGFRGCMDSIYLNGQELPLNNKPRSYAHIEESVDVSPGCLLTATEDC
SSNPCQNGGVCSPSPTGGYYCKCSALYIGTYCEVSVNPCSSNPCLYGGTCIVDNGDFVCQ
CRGLYTGQRCQLSPYCKDEPCKNGGTCFDSLDGAVCQCDAGFRGDRCQSDIDECAGNPCR
NGALCENTHGSYHCNCSLEYRGKHCEDATPNQYVSTPWNIGLAEGIGIIVFITGIFLLVV
VFVLCRKMISRKKKHQAEPEDKHLGPTAAFLQRPYFDSKLNKNIYSDIPPQVPVRPISYT
PSIPSDSRNNLDRNSFEGSAIPEHPEFSTFNPESVHGHRKAVAVCSVAPNLPPPPPSNSP
SDSDSIQKPNWDFDYDTKVVDLDPCLSKKPLEEKPSHPYSARESLSEVQSLSSFQSESCD
DNGYHWDTSDWMPSVPLPDIQEFPNYEVIDEQTPLYSADPNAIDTDYYPGGYDIESDFPP
PPEDFPAPDELPPLPPEFSDQFESIHPPRDMPAAGSLGSSSRNRQRFHLNQYLPNFYPGD
MSEPHKAGASETGPCREPYAPYPPGYQRNFDAPTVENMPMSVYASTASCSDVSACCEVES
EVMMSDYESGDDGHFEEVTIPPLDSQQHTQV
Download sequence
Identical sequences F7AFG6
ENSECAP00000011290 ENSECAP00000011290 9796.ENSECAP00000011290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]