SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000011324 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000011324
Domain Number 1 Region: 64-184
Classification Level Classification E-value
Superfamily SET domain 0.00000149
Family Viral histone H3 Lysine 27 Methyltransferase 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000011324   Gene: ENSECAG00000013571   Transcript: ENSECAT00000014190
Sequence length 282
Comment pep:known chromosome:EquCab2:3:36378671:36384446:-1 gene:ENSECAG00000013571 transcript:ENSECAT00000014190 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYSLRERKGHAYQEVSEPQDDDYLYCENCQNFFIDSCAAHGPPIFVKDSAVDKGHPNRSA
LTLPGLRIRPSGIPEAGLGVWNEASDLPLGLHFGPYEGQITEDEEAANSGYSWLITKGRN
CYEYVDGKDISWANWMRYVNCARDDEEQNLVAFQYHRQIFYRTCRVVRPGCELLVWYGDE
YGQELGIKWGSKWKRELTAGREPKLEIHPCPSCSLAFSSQKFLSQHVERNHPSQILPGTS
ARNHLQPEDPSPGDQNQQQQHSDPHSWKDKAHSQEVKERSKP
Download sequence
Identical sequences F6ZUP7
9796.ENSECAP00000011324 ENSECAP00000011324 ENSECAP00000011324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]