SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000011391 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000011391
Domain Number 1 Region: 21-107
Classification Level Classification E-value
Superfamily Immunoglobulin 4.47e-23
Family V set domains (antibody variable domain-like) 0.0000589
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000011391   Gene: ENSECAG00000013705   Transcript: ENSECAT00000014264
Sequence length 109
Comment pep:known chromosome:EquCab2:1:158856740:158857538:1 gene:ENSECAG00000013705 transcript:ENSECAT00000014264 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSVTGITILLTFGIVGDAKTIQPNAMESTEKETVHLPCNHSTIGGSEYIYWYRQIPYQG
PEYVIHGLKSTETNGMASLTITTDRKSSTLILPQVTLRDTAVYYCMLRE
Download sequence
Identical sequences F6ZM53
ENSECAP00000011391 ENSECAP00000011391 9796.ENSECAP00000011391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]