SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000011397 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000011397
Domain Number 1 Region: 106-190
Classification Level Classification E-value
Superfamily E set domains 0.00000000206
Family Filamin repeat (rod domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000011397   Gene: ENSECAG00000013719   Transcript: ENSECAT00000014272
Sequence length 307
Comment pep:known chromosome:EquCab2:7:22937320:22956190:1 gene:ENSECAG00000013719 transcript:ENSECAT00000014272 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISPVLSPVLTSFPNAITRKLSLMLIFILVFWVIYLVSKDHTKFLFSLRSPITLSQWNVF
RKSTHPEAPLDPAVSPTETELRIKGIMEELGQLVPPRPFTHVNTTTSAAHSRVTILNPQD
THCKGDQLDILLQVRDHLGRRKEYGGDFLRARTSSPALQAGASGKVTDFNNGTYLVSFTL
FWEGQVSLSLLLIHPSEGVSALWRARNQGCDRVIFTGHFANSTSRVLSKCGLILSSSAEL
CKYLDDRDQEAFYCVRPSHVPCEALTHVTTKDGNISYLRKAERSLFHRSNMGVEMMKNFT
SLEVLSC
Download sequence
Identical sequences F6ZM13
ENSECAP00000011397 ENSECAP00000011397 9796.ENSECAP00000011397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]