SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000011427 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000011427
Domain Number 1 Region: 403-546
Classification Level Classification E-value
Superfamily PH domain-like 2.43e-40
Family Third domain of FERM 0.0000101
Further Details:      
 
Domain Number 2 Region: 299-404
Classification Level Classification E-value
Superfamily Second domain of FERM 5.1e-35
Family Second domain of FERM 0.00000386
Further Details:      
 
Domain Number 3 Region: 219-298
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.93e-26
Family First domain of FERM 0.0000956
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000011427   Gene: ENSECAG00000012838   Transcript: ENSECAT00000014308
Sequence length 1003
Comment pep:known chromosome:EquCab2:10:77117492:77224096:-1 gene:ENSECAG00000012838 transcript:ENSECAT00000014308 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTEVGSASEVKKEPDQLGADAAQEKPKEAAENQQPQPSDAEEEKGPQTSPTAESQSSPR
RQKREKEPSDSRGISRFLPPWLKKQKSYNLIVAKDGGEKKEPTQAVVEEQILDKEEPFPE
EERQAKGSAEVAAQRKQQETKVDVKEEKPAVRGPETQRISVFRQQPAEEVSKEREEKVKE
VQDDKSEEAARRETKEVQTNELKAEKASQKAPKKTKTVPCKVTLLDGSEYSCDLEKRAKG
QVLFDKVCEHLNLLEKDYFGLLFQENPEQRNWLDPAKEIKRQLRNLPWLFTFNVKFYPPD
PSQLTEDITRYFLCLQLRQDIASGRLPCSFVTHALLGSYTLQAELGDYDPKEHGSNDLSD
FQFAPNQTKELEEKVAELHKTHRGLSPAQADSQFLENAKRLSMYGVDLHHAKDSEGVDIK
LGVCANGLLIYKDRLRINRFAWPKILKISYKRSNFYIKVRPAELEQFESTIGFKLPNHRA
AKRLWKVCVEHHTFYRLVSPEQPPKAKFLTLGSKFRYSGRTQAQTRQASTLIDRPAPHFE
RTSSKRASRSLDGAPIGDVDQSLMKDFPGPARDVSAYGPGVISPAVAEDGDGRRDVRSPA
RAPHVQLIEGKKNSLRVEGDNIYVRHSNLMLEDLDKAQEDILRHQASISELKRNFMESTP
EPRPNEWEKRRITPLSLQTQGVFHMETLNVVEEKQQAEGWERLRRKSNPQKKELTLGVDP
GERRKEGSIIKQQPTSLSSESSSSSRSEEENCEYPPPTARVTEGTIREEQEEDEEEVEEE
PGRAAKVVEREAPVPAASAGPAGAGLSSVETVTQEHVVAPKIPAEKSLNEGAIEQAVSEE
AEDQRHAVNGEVSHVDIDVLPQIICCSEPPVVKTEMVTISDASQRTEISTKEVPIVQTET
KTITYESPQIDGGAGGDSGTLLTAQTITSESVSTTTTTHITKTVKGGISETRIEKRIVIT
GDADIDHDQALAQAIREAREQHPDMSVTRVVVHKETELEEGEE
Download sequence
Identical sequences F7BID9
9796.ENSECAP00000011427 ENSECAP00000011427 ENSECAP00000011427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]