SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000011440 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000011440
Domain Number 1 Region: 204-364
Classification Level Classification E-value
Superfamily DNA-binding protein LAG-1 (CSL) 1.01e-62
Family DNA-binding protein LAG-1 (CSL) 0.00000567
Further Details:      
 
Domain Number 2 Region: 52-206
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.62e-56
Family DNA-binding protein LAG-1 (CSL) 0.0000419
Further Details:      
 
Domain Number 3 Region: 365-477
Classification Level Classification E-value
Superfamily E set domains 1.51e-35
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000011440   Gene: ENSECAG00000013463   Transcript: ENSECAT00000014322
Sequence length 517
Comment pep:known chromosome:EquCab2:22:34380301:34389642:1 gene:ENSECAG00000013463 transcript:ENSECAT00000014322 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPVGAADPSAPPGPLTHLNLPDNSEARPQSGADGRSHPGSWTRSSPEHATVLREGVRQC
LQQQCQQTVWILHAKVAQKSYGNEKRFFCPPPCVYLAGPGWRVKPVQGQAHQAGETGPTV
CGYMGLDGASGSAAETQKLNFEEQPDSREFGCAKTLFISDADKRKHFRLVLRLVLRGGRE
LGTFHSRLIKVISKPSQKKQSLKNTDLCISSGSKVSLFNRLRSQTVSTRYLSVEDGAFVA
SARQWAAFTLHLADEHCSQGDFPPREGYVRYGSLVQLVCTVTGITLPPMIIRKVAKQCAL
LDVDEPISQLHKCAFQFPGGPPGGGGSYLCLATEKVVQFQASPCPKEANRALLNDSSCWT
IIGTESVEFSFSASLACTREPVTPVPLISTLELSGGGDVATLELHGENFHAGLKVWFGNV
EAETMYRSPRSLVCVVPDVAAFGSDWRWLRTPITVPVSLVRADGLFYPSAFSFTYSPEYS
ARPGPPGAPEPAADADALLESIHHEFTRTNFHLFIQT
Download sequence
Identical sequences F7BHP6
ENSECAP00000011440 9796.ENSECAP00000011440 ENSECAP00000011440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]