SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000011470 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000011470
Domain Number 1 Region: 9-199
Classification Level Classification E-value
Superfamily E set domains 6.72e-79
Family RhoGDI-like 0.0000000194
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000011470   Gene: ENSECAG00000013788   Transcript: ENSECAT00000014355
Sequence length 200
Comment pep:known chromosome:EquCab2:6:42429964:42450918:-1 gene:ENSECAG00000013788 transcript:ENSECAT00000014355 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEKAPEPHLEEDDDELDGKLNYKPPPQKSLKELQEMDKDDESLTKYKKTLLGDGPVVAD
PTAPNVTVTRLTLVCESAPGPITMDLTGDLEALKKETFVLKEGVEYRVKIHFKVNRDIVS
GLKYVQHTYRTGVKVDKATFMVGSYGPRPEEYEFLTPTEEAPKGMLARGTYHNKSFFTDD
DKHDHLTWEWNLSIKKEWTE
Download sequence
Identical sequences F7BBJ0
XP_001501828.1.31192 XP_005611014.1.31192 XP_005611015.1.31192 ENSECAP00000011470 9796.ENSECAP00000011470 ENSECAP00000011470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]