SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000011483 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000011483
Domain Number 1 Region: 3-135
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.21e-49
Family F-box associated region, FBA 0.00008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000011483   Gene: ENSECAG00000013806   Transcript: ENSECAT00000014368
Sequence length 139
Comment pep:known chromosome:EquCab2:10:9901269:9906432:-1 gene:ENSECAG00000013806 transcript:ENSECAT00000014368 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPGAPSQTCFVTSFEWCFKRQLVDLVMEGVWQELLDSAQIEICVADWWGARENCGCVYRL
RVRLLDVYENEVVKFSASPNPVLQWTEPGCRQVYHVFTNFGKGIRYVSFEQYGRDTRSWV
GHYGALVTHSSVRVRIRLS
Download sequence
Identical sequences F7BB35
ENSECAP00000011483 ENSECAP00000011483 9796.ENSECAP00000011483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]