SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000011511 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000011511
Domain Number 1 Region: 1-149
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.4e-66
Family Ephrin receptor ligand binding domain 0.000000367
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000011511   Gene: ENSECAG00000013851   Transcript: ENSECAT00000014402
Sequence length 226
Comment pep:known chromosome:EquCab2:16:70364688:70365380:1 gene:ENSECAG00000013851 transcript:ENSECAT00000014402 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WEEVSGYDENLNTIRTYQVCNVFEPNQNNWLLTTFINRRGAHRIYTEMRFTVRDCSSLPN
VPGSCKETFNLYYYETDSKSAFWSEAPYLKVDTIAADESFSQVDFGGRLMKVNTEVRSFG
PLTRNGFYLAFQDYGACMSLLSVRVFFKKCPSIVQNFAVFPETMTGAESTSLVIARGTCI
PNAEEVDVPIKLYCNGDGEWMVPIGRCTCKPGYEPENSVACKGKPW
Download sequence
Identical sequences F7ARF2
ENSECAP00000011511 9796.ENSECAP00000011511 ENSECAP00000011511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]