SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000011542 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSECAP00000011542
Domain Number - Region: 37-130
Classification Level Classification E-value
Superfamily Tropomyosin 0.085
Family Tropomyosin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000011542   Gene: ENSECAG00000013875   Transcript: ENSECAT00000014435
Sequence length 269
Comment pep:known chromosome:EquCab2:2:54386237:54387059:1 gene:ENSECAG00000013875 transcript:ENSECAT00000014435 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LNDDDFKTAIIKILNELRENSDRQLNEFRSYVTKERTKQILEMKNTIEEIKKNLDALNSR
ADNMEERISNLEDGNIEMLQAEEERKVRLKRNEETLQELSDTIRRCNVRIIGIPEGEEKE
KGAESLFKEIMAENFPNLVREMDLQVTEANRSPNFINARRPTPRHIVVKLAKVNDKEKIL
RTARQKKLTYKGTPIRLSADFSAETLQARREWNDIFKNLKDKNLQPRILYPAKISFKYDG
EIKTFSDKPKLREFIATKPPLQEILRKTL
Download sequence
Identical sequences F7AQ64
9796.ENSECAP00000011542 ENSECAP00000011542 ENSECAP00000011542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]