SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000011576 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000011576
Domain Number 1 Region: 146-390
Classification Level Classification E-value
Superfamily vWA-like 4.13e-83
Family Integrin A (or I) domain 0.000000294
Further Details:      
 
Domain Number 2 Region: 376-480
Classification Level Classification E-value
Superfamily Integrin domains 1.05e-22
Family Integrin domains 0.0035
Further Details:      
 
Domain Number 3 Region: 643-714
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.0000000000105
Family Integrin beta tail domain 0.0096
Further Details:      
 
Domain Number 4 Region: 43-98
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000309
Family Plexin repeat 0.0019
Further Details:      
 
Domain Number 5 Region: 600-640
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000012
Family Integrin beta EGF-like domains 0.0058
Further Details:      
 
Domain Number 6 Region: 559-597
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000176
Family Integrin beta EGF-like domains 0.0048
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000011576
Domain Number - Region: 530-560
Classification Level Classification E-value
Superfamily EGF/Laminin 0.019
Family Integrin beta EGF-like domains 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000011576   Gene: ENSECAG00000013502   Transcript: ENSECAT00000014475
Sequence length 797
Comment pep:known chromosome:EquCab2:6:70193057:70201400:-1 gene:ENSECAG00000013502 transcript:ENSECAT00000014475 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLSTVLVFLLALSGGESELDTKISSPGEATEWGDPDPSLPESCQPAPSCQKCILSHPSC
AWCKQLNFTASGEAEARRCARREELLARGCPPGELEEPRGRQEVLQDEPLSQGARGDGAT
QLAPQRVRVTLRPGEPQQLRVRFLRAEGYPVDLYYLMDLSYSMKDDLERVRQLGHALLEK
LQKVTRSVRIGFGSFVDKTVLPFVSTVPSKLRHPCPSRLERCQPPFSFHHVLSLTGDAEA
FQREVGRQSVSGNLDSPEGGFDAILQAALCQEQIGWRNVTRLLVFTSDDTFHTAGDGKLG
GIFMPSDGHCHLDSNGLYSRSPEFDYPSVGQVAQALSAANIQPIFAVTSTTLPVYQELSK
LIPKSAVGELSEDSSNVVQLIMDAYNSLSSTVTLEHSPLPPGVHISYDSQCGGPEKREGE
AGNRGQCNHVRINQTVNFLVTLQATHCLTEPHLLRFRALGFSEELVVELHTLCDCNCSDT
QLQAPHCSDGQGHLQCGVCSCVPGRLGRFCECSEAELSSPDLESGCRAPNGTGPLCSGKG
RCQCGRCSCSGRSSGRFCECDDANCERHEGVLCGGFGRCQCGVCHCHTNRTGRACECSAD
TDSCVSPEGGLCSGHGHCKCNRCQCLDGYYGALCDQCPGCKTPCERHRDCAECGAFGTGP
LATNCSVACAHANVTLALAPMLDDGWCKERTVDNQLFFFLVEDEVGGRVVLRVRPQEKGA
DHTQAIVLGCIGGIVAVGLGLVLAYRLSVEIYDRREYRRFEKERQQLNWKQDSNPLYKSA
ITTTVNPRFQEADSPPL
Download sequence
Identical sequences F7AKH9
9796.ENSECAP00000011576 ENSECAP00000011576 ENSECAP00000011576 XP_001494917.1.31192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]