SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000011694 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000011694
Domain Number 1 Region: 95-133
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000449
Family Cripto EGF-like domain-like 0.00049
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000011694
Domain Number - Region: 62-93
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000314
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000011694   Gene: ENSECAG00000014029   Transcript: ENSECAT00000014617
Sequence length 147
Comment pep:known chromosome:EquCab2:17:38089864:38090340:1 gene:ENSECAG00000014029 transcript:ENSECAT00000014617 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHFSSSVNVIMVISTAFELGLVAGRLVFRADSIWSQEKPSVCRRPFHFVPSTGIQDSKK
LNKACCLNGRACMLASFCACPLSFYGRNCERDVIKENCRSVPHGTWLPKKCSMCKCWHGR
LRCSPQAFLPGCDGRVMDEHLTASRTP
Download sequence
Identical sequences F6ZLC9
ENSECAP00000011694 ENSECAP00000011694 9796.ENSECAP00000011694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]