SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000011719 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000011719
Domain Number 1 Region: 2377-2449
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.88e-19
Family TB module/8-cys domain 0.0005
Further Details:      
 
Domain Number 2 Region: 1728-1799
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.28e-18
Family TB module/8-cys domain 0.00043
Further Details:      
 
Domain Number 3 Region: 2092-2163
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.44e-18
Family TB module/8-cys domain 0.0000985
Further Details:      
 
Domain Number 4 Region: 993-1062
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.09e-18
Family TB module/8-cys domain 0.00064
Further Details:      
 
Domain Number 5 Region: 355-421
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.62e-18
Family TB module/8-cys domain 0.0018
Further Details:      
 
Domain Number 6 Region: 578-699
Classification Level Classification E-value
Superfamily Growth factor receptor domain 8e-18
Family Growth factor receptor domain 0.0062
Further Details:      
 
Domain Number 7 Region: 1889-2015
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.77e-17
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 8 Region: 2170-2304
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.57e-17
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 9 Region: 756-898
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1e-16
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 10 Region: 209-294
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.84e-16
Family TB module/8-cys domain 0.0013
Further Details:      
 
Domain Number 11 Region: 889-973
Classification Level Classification E-value
Superfamily TB module/8-cys domain 6.02e-16
Family TB module/8-cys domain 0.0014
Further Details:      
 
Domain Number 12 Region: 1359-1494
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000011
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 13 Region: 1197-1335
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000157
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 14 Region: 1568-1641
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000196
Family TB module/8-cys domain 0.0000464
Further Details:      
 
Domain Number 15 Region: 694-766
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000249
Family TB module/8-cys domain 0.0013
Further Details:      
 
Domain Number 16 Region: 2492-2622
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000447
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 17 Region: 1450-1578
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000502
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 18 Region: 2619-2735
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000022
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 19 Region: 1647-1702
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000279
Family EGF-type module 0.00064
Further Details:      
 
Domain Number 20 Region: 2053-2106
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000134
Family EGF-type module 0.0066
Further Details:      
 
Domain Number 21 Region: 1069-1199
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000188
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 22 Region: 2448-2497
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000268
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 23 Region: 493-586
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000377
Family Growth factor receptor domain 0.0072
Further Details:      
 
Domain Number 24 Region: 2330-2379
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000471
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 25 Region: 250-366
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000549
Family Growth factor receptor domain 0.0099
Further Details:      
 
Domain Number 26 Region: 1806-1860
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000314
Family EGF-type module 0.0024
Further Details:      
 
Domain Number 27 Region: 2008-2050
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000312
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 28 Region: 1849-1887
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000723
Family EGF-type module 0.01
Further Details:      
 
Domain Number 29 Region: 1322-1359
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000258
Family EGF-type module 0.01
Further Details:      
 
Domain Number 30 Region: 2293-2335
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000503
Family EGF-type module 0.025
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000011719
Domain Number - Region: 180-213
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00291
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 2828-2874
Classification Level Classification E-value
Superfamily Cadherin-like 0.0045
Family Cadherin 0.015
Further Details:      
 
Domain Number - Region: 146-179
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0943
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000011719   Gene: ENSECAG00000012011   Transcript: ENSECAT00000014646
Sequence length 2913
Comment pep:known chromosome:EquCab2:14:46233696:46467528:1 gene:ENSECAG00000012011 transcript:ENSECAT00000014646 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRRRRLCLQPYFVWLSCVALWAQGTAGQPQPPPLKPPRPQSPPQQVRPAAAGSEGGFAV
PEYREEGAAATTRVRRRGQQDVLRGPNVCGSRFHSYCCPGWKTLPGGNQCIVPICRNSCG
DGFCSRPNMCTCSSGQISPTCGSKSIQQCNVRCMNGGTCADDHCQCQKGYIGTYCGQPVC
ENGCQNGGRCIGPNRCACVYGFTGPQCERDYRTGPCFTQVNNQMCQGQLTGIVCTKTLCC
ATIGRAWGHPCEMCPAQPQPCRRGFIPNIRTGACQDVDECQAIPGICQGGNCVNTVGSFE
CKCPAGHKQSETTQKCEDLDECSIIPGICETGECSNTVGSYFCVCPRGYVTSTDGSRCID
QRTGTCFSGLVNGRCAQELPGRMTKMQCCCEPGRCWGVGTIPEACPVRGSEEYRRLCMDG
LPIGGIPGSAGSRPGGAAGNGFAPSGNGNGYGPGGTGFIPIPGGNGFSPGVGGAGVGAGG
QGPIITGLTILNQTIDICKHHANLCLNGRCIPTVSSYRCECNMGYKQDANGDCIDVDECT
SNPCTNGDCVNTPGSYYCKCHAGFQRTPTKQACIDIDECIQNGVLCKNGRCVNTDGSFQC
ICNAGFELTTDGKNCVDHDECTTTNMCLNGMCINEDGSFKCICKPGFVLAPNGRYCTDVD
ECQTPGICMNGHCINNEGSFRCDCPPGLAVGVDGRVCVDTHMRSTCYGGIKKGVCVRPFP
GAVTKSECCCANPDYGFGEPCQPCPAKNSAEFHGLCSSGVGITVDGRDINECALDPDICA
NGICENLRGSYRCNCNSGYEPDASGRNCIDIDECLVNRLLCDNGLCRNTPGSYSCTCPPG
YVFRTETETCEDINECESNPCVNGACRNNLGSFNCECSPGSKLSSTGLICIDSLKGTCWL
NIQDNRCEVNINGATLKSECCATLGAAWGSPCERCELDTACPRGFARIKGVTCEDVNECE
VFPGVCPNGRCVNSKGSFHCECPEGLADVTCWVCSDIRMEQCYLKWDEDECVHSVPGKFR
MDACCCAVGAAWGTECEECPKPGTKEYETLCPRGPGFANRGDVLTGRPFYKDINECKAFP
GMCTYGKCRNTIGSFKCRCNSGFALDMEERNCTDIDECRISPDLCGSGICVNTPGSFECE
CFEGYESGFMMMKNCMDVDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREDCVDV
NECSLSDNLCRNGKCVNMIGTYQCSCNPGYQATPDRQGCTDIDECMIMNGGCDTQCTNSE
GSYECSCSEGYALMPDGRSCADIDECENNPDICDGGQCTNIPGEYRCLCYDGFMASMDMK
TCIDVNECDLNSNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMH
ASCLNVPGSFKCSCREGWVGNGIKCIDLDECSNGTHQCSINAQCVNTPGSYRCACSEGFT
GDGFTCSDVDECAENINLCENGQCLNVPGAYRCECEMGFTPASDSRSCQDIDECSFQNIC
VFGTCNNLPGMFHCICDDGYELDRTGGNCTDIDECADPINCVNGLCVNTPGRYECNCPPD
FQLNPTGVGCVDNRVGNCYLKFGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETC
PPVNSTEYYTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQCECPQGY
YLSEETRICEDIDECFAHPGVCGPGTCYNTLGNYTCICPPEYMQVNGGHNCMDMRKSFCY
RSYNGTTCENELPFNVTKRMCCCTYNVGKAWNKPCEPCPTPGTADFKTICGNIPGFTFDI
HTGKAVDIDECKEIPGICANGVCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLC
QRNADCINSPGSYRCECAAGFKLSPNGACVDRNECLEIPNVCSHGLCVDLQGSYQCICHN
GFKASQDQTMCMDVDECERHPCGNGTCKNTVGSYNCLCYPGFELTHNNDCLDIDECSSFF
GQVCRNGRCFNEIGSFKCLCNEGYELTPDGKNCIDTNECVALPGSCSPGTCQNLEGSFRC
ICPPGYEVKSENCIDINECDEDPNICLFGSCTNTPGGFQCICPPGFVLSDNGRRCFDTRQ
SFCFTNFENGKCSVPKAFNTTKAKCCCSKMPGEGWGDPCELCPKDDEVAFQDLCPYGHGT
VPSLHDTREDVNECLESPGICSNGQCINTDGSFRCECPMGYNLDYTGVRCVDTDECSIGN
PCGNGTCTNVIGSFECNCNEGFEPGPMMNFDNINECAQNPLLCAFRCMNTFGSYECTCPI
GYALREDQKMCKDLDECAEGLHDCESRGMMCKNLIGTFMCICPPGMTRRPDGEGCVDENE
CRTKPGICENGRCINTIGSYRCECNEGFQSSSSGTECLDNRQGLCFAEVLQTMCQMASSS
RNLVTKSECCCDGGRGWGHQCELCPLPGTAQYKKICPHGPGYTTDGRDIDECKVMPNLCT
NGQCINTMGSFRCFCKVGYTTDISGTSCVDLDECSQSPKPCNFICKNTEGSYQCSCPRGY
VLQEDGKTCKGDHLDECQTKQHNCQFLCVNTLGGFTCKCPPGFTQHHTACIDNNECGSQP
SLCGAKGICQNTPGSFSCECQRGFSLDATGLNCEDVDECDGNHRCQHGCQNILGGYRCGC
PQGYIQHYQWNQCVDENECSNPNACGSASCYNTLGSYKCACPSGFSFDQFSSACHDVNEC
SSSKNPCNYGCSNTEGGYLCGCPPGYYRVGQGHCVSGMGFNKGQYLSLDTEVDEENALSP
EACYECKINGYSNKDSRQKRSVHEPEATAVEQISLESVDMDSPMKMKFNLSGLGSKEHIL
ELMPAIEPLNNHIRYVISQGNDDGVFRIHQRNGLSYLHTAKRKLVPGTYTLEITSIPLYK
KKELKKLEDSNEDDYLLGELGEALRMRLQIQLY
Download sequence
Identical sequences F7BMQ7
9796.ENSECAP00000011719 ENSECAP00000011719 ENSECAP00000011719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]