SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000011727 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000011727
Domain Number 1 Region: 104-266
Classification Level Classification E-value
Superfamily C-type lectin-like 3.88e-19
Family C-type lectin domain 0.0061
Further Details:      
 
Domain Number 2 Region: 26-67
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000327
Family LDL receptor-like module 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000011727
Domain Number - Region: 265-330
Classification Level Classification E-value
Superfamily FnI-like domain 0.000889
Family VWC domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000011727   Gene: ENSECAG00000014063   Transcript: ENSECAT00000014659
Sequence length 550
Comment pep:known chromosome:EquCab2:Un0002:123384:209760:-1 gene:ENSECAG00000014063 transcript:ENSECAT00000014659 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPKGDSGAFLLLFLLVLTVTKPLRPELRCNPGQFACRSGAIQCIPLPWQCDGWVTCEDE
SDEADCPEVTGESRPYHGKEAVDPRQGRARGGEPTHLHAVNVAQPVRFSSFLGKCPTGWH
HYEGTASCYRVYLSGENYWDAAQTCQRVNGSLATFSTDQELRFVLAQEWDQPERSFAWQD
QHKLWVGYQYVVTGRNRSLEGHWEVAFKGSSEVFLPPDPIFASAMSESDNVFCAQLQCFH
FPTLRHHDLHSWHAENCYEKSSFLCKRSQTCVDIKDNVVDEGFYFTPKGDDPCLSCTCHG
GEPEMCVAALCERPQGCQQYRKDPKECCKFMCLDPDGNSLFDSMASGMRLIVSCISSFLI
LSLLLFMVHRLRQRRRERIESLIGANLHHFNLGRRIPGFDYGPDGFGTGLTPLHLSDDGE
GGTFHFHDPPPPYTAYKYPDIDQPDDPPPPYEASINPDSVFYDPADDDAFEPAEAGPPTP
GDGGGEGASSRCLEQPLPATGAPLADLEDSADSSSALLVPPDPTQSGSTSATEALPGGGH
HSRSSLNTVV
Download sequence
Identical sequences H9GZY1
9796.ENSECAP00000011727 ENSECAP00000011727 ENSECAP00000011727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]