SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000011731 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000011731
Domain Number 1 Region: 32-157
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000314
Family Growth factor receptor domain 0.014
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000011731
Domain Number - Region: 300-327
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0527
Family EGF-type module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000011731   Gene: ENSECAG00000013861   Transcript: ENSECAT00000014666
Sequence length 643
Comment pep:known chromosome:EquCab2:13:27009483:27022119:1 gene:ENSECAG00000013861 transcript:ENSECAT00000014666 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGWLSSLTSMRMVTVVTYWVIIAANTDTSEARSCIDCHSNATCLEDGAATTCSCQDGFTG
DGLVCVDLNECATPGAHNCSANSSCVNTLGSYTCVCLNGFRQTPGLGCIDVDECAEPGLS
GCHALATCVNSKGSYSCVCPAGYLGDGRHCECSPGSCGQGLDCVREGAAHVCVDPCQAHS
ILDEYWRSSDYGTGYACDSHLSGWYRFMGQGGVRMAETCVPTLRCNTAAPMWLNGTHPSS
DEGIVSRTACAHWSGNCCLWDAPVQVKACPGGYYVYNLRAPPECHLAYCTDPRSVEGTCD
ECSVDEECKSVNGKWHCQCKQDFNITDLSHLERKLECGINDIKMSLGKCQLKSLGFEKVY
MYLLDSQCSGFAERGDRDWVSVVTPTRDGPCGTVLTTNETHATYSNTLFLADEIIIRDVN
IKINFACSYPLDMKVSLKTSLHPIVSSLNISVGGTGMFTVRMALFQNPTFTQPYQGSSVT
LSTDAFLYVGTILDGGDVSRFALLMTNCYATPSSNATDPLKYFIIQDNCPRTEDSTIRVV
ENGESPQGRFSVQMFRFAGNYDLVYLHCEVYLCDNINENCKPTCSGTRVRTGGSIDQSRV
LNLGPISRKAVQAAVSKAASSSLGLLKVWLPLFLSAILTLMSQ
Download sequence
Identical sequences F7BM54
ENSECAP00000011731 XP_001488229.1.31192 XP_008536499.1.77740 ENSECAP00000011731 9796.ENSECAP00000011731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]