SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000011803 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000011803
Domain Number 1 Region: 303-551
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.95e-68
Family Eukaryotic proteases 0.0024
Further Details:      
 
Domain Number 2 Region: 87-197
Classification Level Classification E-value
Superfamily SRCR-like 8.37e-17
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0076
Further Details:      
 
Domain Number 3 Region: 236-273
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000011
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 4 Region: 199-233
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000118
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 5 Region: 23-83
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000634
Family Ovomucoid domain III-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000011803   Gene: ENSECAG00000013869   Transcript: ENSECAT00000014752
Sequence length 560
Comment pep:known chromosome:EquCab2:2:115961736:115997050:1 gene:ENSECAG00000013869 transcript:ENSECAT00000014752 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SQEDLLEEKCLTEKHTHLSCNKVFCQPWQKCIQGSCSCKLPYQCPKNGTTVCSTNGRSYP
TYCQQKSVECLRPGAKFLNNGICTAEGKFDVSLKYGNTDSEGFVEVKLVNQEKKMFVCKR
NWSMTQANVACLDLGFQLGELSQSRVQLSGLEENSTECLYVRCRGLETSLAECTITKRTT
NSAWGLAAVVCYTQNTVLPENESFQCVNGKHIPRKNACNGVNDCGDQSDELCCKGCRGRS
FFCKSGVCIPNQHKCDGEVDCITGEDEIGCEGNLKLAQNKEEILTADMDAERKWIKSFSP
KLSCGVKNSSPVRRKRVVGGQEAHVGDFPWQVAIKDVTERINCGGIYIGGCWILTAAHCV
RVSKVHRYQIWTSLVDWLRPNSEIGIQWANRIIIHEGYNGTTYQNDIALIELKKRPNQKE
CVLLNSIPACVPWSPYLFRPNDKCIISGWGREKDHQKVYSLRWGEVHLISNCSRFYPNRY
FEKEMECAGTVDGSIDACKGDSGGPLVCQDANNVTYVWGVVSWGEKCGRPDFPGVYTKVA
NYFDWISHHVGRSLISQHNV
Download sequence
Identical sequences F7AU56
9796.ENSECAP00000011803 ENSECAP00000011803 ENSECAP00000011803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]