SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000011857 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000011857
Domain Number 1 Region: 388-563
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.65e-72
Family Rel/Dorsal transcription factors, DNA-binding domain 0.000000109
Further Details:      
 
Domain Number 2 Region: 565-665
Classification Level Classification E-value
Superfamily E set domains 7.56e-30
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000011857   Gene: ENSECAG00000014089   Transcript: ENSECAT00000014815
Sequence length 1034
Comment pep:known chromosome:EquCab2:3:18409635:18499860:1 gene:ENSECAG00000014089 transcript:ENSECAT00000014815 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PIDLEPDDCASIYIFNVDPPPSTLNSPLCLPHHGLPSHSSVLSPPFQLQGHKNYEGTCEV
PESKYSPLGGPKPFECPSIQITSISPNCHQEIDAHEDDLHINDPERDYLERPSRDHLYLP
LEPSYRESSLSPSPASSISSRSWFSDASSCESLSHIYDDVDSELNEAAARFTLGSPLTSP
GGSPGGCPGEDSWHQQYGLGHSLSPRQSPCHSPRSSVTDENWLSPRPASGPSSRPTSPCG
KRRHSSAEVCYAGSLSPHHSPVPSPGHSPRGSVTEDTWLNVQGGSGLGPALFPFQYCVET
DIPLKTRKTSEDQATVLPGKLELCSDDQGNLSPSRETSVDDGLGSQYPLKKDSSGDQFLS
VPSPFTWSKPKPGHTPIFRTSSLPPLDWPLPTHFGQCELKIEVQPKTHHRAHYETEGSRG
AVKASTGGHPVVKLLGYSEKPINLQMFIGTADDRYLRPHAFYQVHRITGKTVATASQEII
IASTKVLEIPLLPENNMSASIDCAGILKLRNSDIELRKGETDIGRKNTRVRLVFRVHIPQ
PNGKVLSLQTASIPVECSQRSAQELPHIEKYSINSCSVNGGHEMIVTGSNFLPESKIIFL
EKGQDGRPQWEVEGKIIREKCQGAHIVLEVPPYHNPAVTAAVQVHFYLCNGKRKKSQSQR
FTYTPVLMKQEHREEIDLSSVSSLPMPHPPQTQRPSSDIGHPHESELSAQRSLVCPIQQT
YAPMVTSSHLPQLQCRDESAGKEQHMIPSSVMHQPFQVTPTPPLGSSYQPMQTNVMYNGP
TCLPINAASSQEFDPVLFQQDAALPSLIHLGCQPPSSIPFHSSNSGSAGHLLAHTPHSVQ
TLPHLPSMGYHCSNTVRGSHSSPVTDQVTGQPSPQLQPITYGPSHSGSATTASPAASHPL
ASSPLSGPPSPQLQPMPYQSPSSGTASSPSLATRMQSGQHSTQAQSTGQGGLSAPSSLIC
HSLCDPASFPPDEATVNIKPEPEEQEPNFSTIGLQDITLDDDQFMSDLEHQPSGSAKKWP
NHSELSFPAPFWRI
Download sequence
Identical sequences F7ANZ7
9796.ENSECAP00000011857 ENSECAP00000011857 ENSECAP00000011857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]